KEGG   Phytophthora infestans: PITG_01099Help
Entry
PITG_01099        CDS       T01333                                 

Definition
(RefSeq) elongator complex protein 3
  KO
K07739  elongator complex protein 3 [EC:2.3.1.48]
Organism
pif  Phytophthora infestans
Brite
Enzymes [BR:pif01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     PITG_01099
Transfer RNA biogenesis [BR:pif03016]
 Eukaryotic Type
  tRNA modification factors
   Elongator complex
    PITG_01099
Chromosome and associated proteins [BR:pif03036]
 Eukaryotic Type
  Histone modification proteins
   HATs (histone acetyltransferases)
    PITG_01099
   HAT complexes
    Elongator complex
     PITG_01099
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Radical_SAM_C Radical_SAM Acetyltransf_1 Acetyltransf_10 Acetyltransf_7 FR47
Motif
Other DBs
NCBI-GeneID: 9473496
NCBI-ProteinID: XP_002909618
UniProt: D0MSG3
AA seq 541 aa AA seqDB search
MPGDTNASGYVLAIAGIVDALIAAYEDQEPVNMTRLKNDVAKQFRLPSMPKLVDIISAVP
EDYKEKLLPFLKAKPVRTASGIAVVAVMCKPHRCPHIAMTGNICVYCPGGPDSDFEYSTQ
SYTGYEPTSMRAIRARYDPALQTRHRVAQLKRLGHSVDKVEFIVMGGTFLSLDSRYRDYF
IRSLHDALSGHSSTSVDEAVRYSEQSSTKCTAITIETRPDYCLKPHLHDMLRYGCTRIEI
GVQSVYEDVARDTNRGHTVAAVSHCFQLAKDCGFKIVAHLMPDLPNMGMERDLAGFREFF
ENPRFRSDGIKLYPTLVIRGTGLYELWKTGTYKNYSPEDLVDLMARLLALVPPWTRVYRV
QRDIPMPLVTSGVEHGNLRELALARMRDLGLVCNDVRTREVGIKGIHDQSVPDQVELVRR
DYVANGGWETFLSYEDPQQNILIGLLRLRQASVASFRDEITPGCSIVRELHVYGSSVPLH
ARDPTKFQHQGFGTLLMEEAERIAYEEHGSHKLVVIAGVGTRNYYRKLGYEIDGPYMSKY
L
NT seq 1626 nt NT seq  +upstreamnt  +downstreamnt
atgccaggtgacaccaacgcgagcggctacgtgctggccattgctggcatcgtagacgca
ctcatcgcagcctacgaggatcaagagcctgtcaacatgacgcgcttaaagaacgacgtg
gctaagcagttccgcctcccgtcgatgcccaaacttgtggacattatctctgccgtgcca
gaggactacaaggagaaactcctgccgtttctcaaggctaaacccgtgcgcaccgcgtct
ggtattgctgtcgttgccgtaatgtgcaagccccatcgatgcccacacattgcaatgacc
ggtaatatctgtgtctactgtccgggggggcccgactcggactttgagtactctacgcag
tcttacacaggctacgagcccaccagcatgcgagctatccgtgctcgctacgatcccgct
ctgcaaacgcgacaccgtgtggcccaactgaagaggctgggccactcggtagataaagtg
gagtttatcgtcatgggaggcaccttcttgtcgctggactctcggtaccgggattatttc
atccggagcttgcacgatgctctgtctggacactcgtcaacgagtgtggacgaagcggtg
aggtactcggagcagagttcgaccaagtgcacagcgattacgatcgagacgaggcccgac
tattgtctcaagccgcacctgcacgacatgctgcgttacggctgtacacgcattgagatt
ggggtccagagcgtgtacgaagacgtggcgcgcgatacgaaccgtggtcataccgtggct
gccgtctcgcattgtttccagctggccaaggactgcggatttaagatcgtagctcacttg
atgccggatctgccgaatatgggcatggagcgcgaccttgcagggttccgagagttcttt
gagaatccgcgcttccgtagtgatggtatcaagttgtatccgacacttgtgattcgtgga
acgggactgtacgagctgtggaagactgggacatacaagaactactcgcctgaagacctg
gtggacctgatggcccgattgctcgctctggtgccgccatggactcgcgtgtaccgtgtc
caacgagacattcccatgccgctcgtgacgtcaggtgttgagcatggcaatttgagagaa
ctggccttagcacgaatgcgagaccttggacttgtttgcaacgatgtgcgtacccgcgag
gttggcatcaagggcatccatgaccaaagtgtaccggaccaagtggagcttgtgcgtcgt
gactatgtggccaatggtggttgggaaacgttcctctcgtacgaagatcctcagcagaac
attctcatcggcttactgcgtcttcgtcaggcgagtgtggcgtcgttccgtgatgaaatt
actccggggtgctccatcgtacgtgagctgcatgtgtacgggtcgtcggttcctcttcac
gcgcgtgacccgaccaaatttcaacatcaaggcttcggtacgttgctaatggaagaagca
gaacgcatcgcatacgaagagcatgggtcgcacaaactcgtggttatcgctggcgtcggc
actcgcaactactaccgcaaactgggctatgagatcgatggaccttacatgtccaaatat
ttatga

DBGET integrated database retrieval system