KEGG   Phytophthora infestans: PITG_02026Help
Entry
PITG_02026        CDS       T01333                                 

Definition
(RefSeq) succinyl-CoA ligase subunit alpha, mitochondrial precursor
  KO
K01899  succinyl-CoA synthetase alpha subunit [EC:6.2.1.4 6.2.1.5]
Organism
pif  Phytophthora infestans
Pathway
pif00020  Citrate cycle (TCA cycle)
pif00640  Propanoate metabolism
pif01100  Metabolic pathways
pif01110  Biosynthesis of secondary metabolites
pif01130  Biosynthesis of antibiotics
pif01200  Carbon metabolism
Module
pif_M00009  Citrate cycle (TCA cycle, Krebs cycle)
pif_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:pif00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    PITG_02026
   00640 Propanoate metabolism
    PITG_02026
Enzymes [BR:pif01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.4  succinate---CoA ligase (GDP-forming)
     PITG_02026
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     PITG_02026
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: CoA_binding Ligase_CoA Succ_CoA_lig CoA_binding_2
Motif
Other DBs
NCBI-GeneID: 9479418
NCBI-ProteinID: XP_002908607
UniProt: D0MUP3
AA seq 339 aa AA seqDB search
MDRELPHSPFRLEARSKVIVSMFARTPVKTVAAVAQATRSMSASAKVWINKDTKVICQGF
TGKQGTFHSQQAIEYGTNMVGGVTPKKGGSTHLGLPVFNTVAEAKKETGADASVIYVPPP
FCAASIIEAIEAKIPLVVAITEGIPQQDMVKVKWHLRNQSTTRLIGPNCPGIIKPGECKM
GIMPGYIHQKGKIGIVSRSGTLTYEAVAQTTALGLGQSTVIGIGGDPFNGTNFIDCLERF
TNDPETEGIIMVGEIGGSAEEEAAEWLMAHGDPNKPVVSFIAGTTAPPGRRMGHAGAIVS
GGKGTAAGKFAALEAAGVAVTRSPARLGVTLYEEMQKRA
NT seq 1020 nt NT seq  +upstreamnt  +downstreamnt
atggatcgtgagctcccccactctccgttcagactcgaggctcgcagcaaggtcatcgtc
agtatgttcgctcgcacgcccgtcaagaccgtggccgccgtcgcgcaggccacgcgcagc
atgtctgcgtccgccaaggtgtggatcaacaaggacaccaaggtcatctgccaaggcttc
accggcaagcagggtacattccactcgcaacaggctattgagtacggcaccaacatggtg
ggcggtgtgacccccaagaagggtggctccacgcacctgggtcttcccgtgttcaacact
gtggctgaggccaagaaggagactggtgctgacgcttccgtcatctatgtgccgcctccg
ttctgtgcggcttctatcattgaggccatcgaggctaagattcctctcgttgtggctatt
acggagggcattccgcagcaggacatggtcaaggtcaagtggcacttgcgcaaccagagc
accacacgccttattggccccaactgccccggtatcatcaagcctggcgagtgcaagatg
ggcattatgcctggatacattcaccagaagggtaagatcggcattgtgtcgcgctccggt
accctgacgtacgaggctgtggctcagactacggctctgggccttggtcagtccaccgtt
attggtattggcggtgacccgttcaacggcacaaacttcattgactgcctggagcgcttc
accaacgacccggaaactgaaggtatcattatggtgggcgagatcggcggatctgccgag
gaggaggctgcagagtggctcatggcccacggagaccccaacaagcccgtggtgagcttc
attgccggcacgacggctcctcctggacgtcgtatgggccacgctggcgctattgtgtca
ggcggcaagggtacggctgctggtaagttcgctgcgcttgaggctgctggcgttgcggtg
acgcgatcgcctgctcgtcttggcgtgacgctgtacgaggagatgcagaagcgcgcttaa

DBGET integrated database retrieval system