KEGG   Phytophthora infestans: PITG_02776Help
Entry
PITG_02776        CDS       T01333                                 

Definition
(RefSeq) multiple inositol polyphosphate phosphatase, putative
  KO
K03103  multiple inositol-polyphosphate phosphatase / 2,3-bisphosphoglycerate 3-phosphatase [EC:3.1.3.62 3.1.3.80]
Organism
pif  Phytophthora infestans
Pathway
pif00010  Glycolysis / Gluconeogenesis
pif00562  Inositol phosphate metabolism
pif01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pif00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    PITG_02776
   00562 Inositol phosphate metabolism
    PITG_02776
Enzymes [BR:pif01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.62  multiple inositol-polyphosphate phosphatase
     PITG_02776
    3.1.3.80  2,3-bisphosphoglycerate 3-phosphatase
     PITG_02776
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: His_Phos_2
Motif
Other DBs
NCBI-GeneID: 9476795
NCBI-ProteinID: XP_002907668
UniProt: D0MX69
AA seq 352 aa AA seqDB search
MFATKTKYWDQRKAPESPRRQEFELIQTQLVARHGIRYPTLGNIKKINGLLKRLKPYEDS
LPHWMKNYTLPYNKSVAGELADAGKQELWKLGARNLARSNHENPDLLLRFFDQCARYQRD
VKKNQTAQQQLHEYQNSNDMTKIALWLKHSLGLKREGIEFSPKDLMAVQSACAFDIALYH
LKHHWCSLMSMTFIHSLDYLDDLEQFYWIGGGYNLNYEMAAVLLRELFDSMKGKVNGSSS
LVGNFFFAHAETTLPLMTLLGYGDRSPLLANFTQAEIKSRGFRSSKLSPFAANIEFRLFK
SKTNDEDVYVQILVNEKESEIPDCGRVFCKLSELEKQWDYYLNTYDFTKNCA
NT seq 1059 nt NT seq  +upstreamnt  +downstreamnt
atgttcgctacaaaaaccaaatattgggatcaacgcaaagctcccgaatctccacgaaga
caggaatttgagctcattcagacgcaactcgtggcgcgccatggaattcggtacccaact
ttgggcaatataaagaaaatcaatggccttttaaagcgactaaagccttacgaagattcg
ctgccgcattggatgaagaactacactctgccgtacaataaaagtgtggcgggagagctt
gcggatgcaggaaagcaggagctgtggaaacttggtgctcgcaacctggcgagaagtaac
cacgaaaaccctgatcttctgctgcggtttttcgaccaatgtgcacgctaccaacgagat
gtcaagaagaatcagacagcacaacaacaactgcatgaatatcaaaactcaaatgacatg
acgaagattgcgctttggctaaaacattcgcttgggttgaagagggaaggcatcgaattc
tcaccgaaggacctgatggccgtgcaatctgcttgcgcttttgatatcgcactttaccac
ctcaaacatcattggtgctcgttgatgtcgatgactttcatccattcgttggactatctg
gacgaccttgagcagttctattggattggaggtggatacaatcttaactacgaaatggct
gcagtactcctgcgcgaacttttcgattcaatgaaaggaaaagtgaacggcagtagctca
ttggtgggcaatttcttcttcgcacacgctgagacgacgctccctttgatgacgttgttg
gggtatggggatcgctcgcctctactggcaaacttcacacaagccgagatcaaatcacgg
ggtttcagatcatcaaaactctccccgtttgcagccaatatcgagtttcgcttgtttaaa
agtaaaacaaatgacgaagatgtgtacgtccaaattcttgtaaacgaaaaagaatccgag
attcctgactgtggacgcgtgttctgcaagttgtcggagctggaaaagcagtgggactac
tacttgaacacgtacgactttacgaaaaactgtgcgtaa

DBGET integrated database retrieval system