KEGG   Phytophthora infestans: PITG_03068Help
Entry
PITG_03068        CDS       T01333                                 

Definition
(RefSeq) hsp70-like protein
Organism
pif  Phytophthora infestans
Pathway
pif03040  Spliceosome
pif04141  Protein processing in endoplasmic reticulum
pif04144  Endocytosis
Brite
KEGG Orthology (KO) [BR:pif00001]
 09120 Genetic Information Processing
  09121 Transcription
   03040 Spliceosome
    PITG_03068
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    PITG_03068
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    PITG_03068
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: HSP70 DUF1464 FGGY_C
Motif
Other DBs
NCBI-GeneID: 9464413
NCBI-ProteinID: XP_002906169
UniProt: D0MZA7
AA seq 638 aa AA seqDB search
MVGVNPDSRQGKSPHDFGATSDSEFTPPTMDEISETASCSIGIDFGRSKCEAAVVSDTGS
VILIPFEPHSTENCYSLSSFVSMGVAHSGEGEVGLQSINRAKAGHSYTVYDLTMLLGQKT
ETLSAQDVNRWAFTLQAGAAGKAVVESPAKGNVPDLVYPEQVAALLFATIKNRAETFTGK
RVTTAVVTVPAAYNRTQRQAVWDACRIANLDVERLVISSTASAVANADSVIDAAATVFEK
TIVVVDCGAGSLNVTLARVPTAGNMELGGEALTDRLFEHFHSEAKVVDTSSKSTSPAFSR
RLRRACMLAQRILSTSQQAAIDLPWQPRRACGSGAVNGVMTGFSSSIWRADFESLCGSET
WDCLPTTVEQVLATAKVKKEDVDAVLVTGGAMQVPKLREVLGDCFAEHWNRIVDLPKHTA
AIGAAMIAAQSSGRVLKNETTPLSLGIRSSSGDTLIVVPPSSTVPTRQAQLYYASCQREI
KFDILEGLVANRTAGATPNRLEHCLGRILIDGKRASSPFILKLEIAFELDATCELEVVIS
DKSNDRVTRLLVSGDETCLQGEAITLAQTVCIPPGDLFLLRSKIEHASAWLDLLDASHIS
SQELLTARDYLRQIRMLHLSSTANSALVQLRQEMNLFN
NT seq 1917 nt NT seq  +upstreamnt  +downstreamnt
atggtgggcgttaaccctgatagccgtcaaggcaagagccctcatgattttggagcaaca
agcgactctgaatttacgccaccaaccatggatgagatcagcgaaacagcttcctgtagt
atcggcattgactttggccgttcaaaatgcgaggcagccgttgtcagtgacacaggcagt
gttatactgattccttttgagccacatagcactgaaaactgctactcactatcgagtttc
gtctcaatgggggttgctcactcgggagaaggggaagtaggactccaatcaattaaccga
gcgaaggctggacattcgtatactgtgtacgacctgacaatgctgcttgggcagaagaca
gagacgctctcagcacaagacgtcaatcgttgggcttttactcttcaagctggagctgct
ggcaaagctgtcgtggaatctcctgcgaaaggcaacgtccctgatctagtgtatcccgaa
caagttgcagccttgctcttcgctacgatcaagaaccgagctgagactttcactggaaag
cgtgtcactactgctgtggtgacggtaccagcagcttataaccggacccagcgtcaggcc
gtttgggacgcctgcagaattgctaacttggatgtcgagcggctcgttatttcatccacg
gcgtctgctgtcgccaatgcagattccgtaattgacgctgcggctactgtcttcgagaag
acgatagttgtagtagactgtggtgctggaagtttgaatgtaacattggctcgggtacct
acagcaggaaatatggagctgggaggtgaagctctaacggatcgtctttttgagcatttc
cacagtgaggcgaaggtagtcgacaccagttcaaagtcgacaagtccagcattttccaga
cgcctgcgacgtgcgtgtatgttggctcaaaggatcctttcgacttcacagcaagctgca
attgatctgccttggcagcctcgacgtgcctgtggctctggtgcagtcaatggagtgatg
acagggttcagtagcagcatctggcgagcagatttcgagtcgttgtgtgggtcggagacg
tgggactgcttgccgaccaccgttgagcaagttctcgcgaccgcgaaagtaaagaaggag
gacgttgatgcggtcttggtcactggaggagccatgcaagtgccaaaactccgtgaagtt
cttggagactgctttgccgaacactggaatcgaatcgtggatctaccgaaacataccgct
gcaattggtgcagcgatgattgcagctcagagcagtggtcgtgtattgaagaatgagacc
acgccgttgtcgcttgggattcgcagttccagtggagatacactaattgtagtgcctcct
agctcgacggtaccgacgcgacaagcacaactgtactacgcaagttgccaacgggagatc
aagtttgacattctggaagggttagttgcgaatcgcactgccggcgctactccgaatagg
ctggagcactgtctgggtcgtattcttatcgatgggaaacgcgcatcttcccctttcatt
ctaaaacttgagatcgcgttcgagctggatgcgacttgcgagttggaagtcgtgatctcg
gataaatcgaatgatcgagtcactcgtttgctggtgtctggagatgaaacgtgtctccaa
ggtgaagcaattacgctcgcccaaactgtctgcatcccaccgggagatctctttcttctg
cgttcgaagatcgaacatgcgagtgcgtggcttgatctgcttgatgccagccacatctcg
agccaggaacttctcaccgcgcgggattatctgcgtcagatccgcatgctgcatctttcg
agcactgcaaacagcgcgttagtccagttacgccaggagatgaacctgttcaactga

DBGET integrated database retrieval system