KEGG   Phytophthora infestans: PITG_04851Help
Entry
PITG_04851        CDS       T01333                                 

Definition
(RefSeq) arginase
  KO
K01476  arginase [EC:3.5.3.1]
Organism
pif  Phytophthora infestans
Pathway
pif00220  Arginine biosynthesis
pif00330  Arginine and proline metabolism
pif01100  Metabolic pathways
pif01110  Biosynthesis of secondary metabolites
pif01130  Biosynthesis of antibiotics
pif01230  Biosynthesis of amino acids
Module
pif_M00134  Polyamine biosynthesis, arginine => ornithine => putrescine
Brite
KEGG Orthology (KO) [BR:pif00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00220 Arginine biosynthesis
    PITG_04851
   00330 Arginine and proline metabolism
    PITG_04851
Enzymes [BR:pif01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.1  arginase
     PITG_04851
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Arginase
Motif
Other DBs
NCBI-GeneID: 9478755
NCBI-ProteinID: XP_002905554
UniProt: D0N266
AA seq 355 aa AA seqDB search
MQRRVPTSLLRCMQQRGISSSSSRQWDQVRPHFHAGAHGNPKLNLPQTVSIIGAPMTYGQ
PLLGTDGGPDLLREAGLHKTLVDLGWSVEENGNLNFVAPSSNDPTLDSRYGKAKQCFPVG
NGTKQLYETFKQKAGEGKFCLVLGGDHTIGAGSLAGLLSVHPDAGVIWVDAHADINTPAD
SESGNMHGMPIAFLMDGMVDSSKIPGFEWLSNGPKMKPEQLVYVGLRDVDSFERRVIHEK
GIKAFSMQEVDRYGIGKTMEMALDHLCGKKQRPLHMSYDIDAVDPLVAPSTGTRVRGGLT
WREAHYVAEAVAETNLMVGLDMVEVNPTLAPGDGAQITVDMALMLISSALGNRIL
NT seq 1068 nt NT seq  +upstreamnt  +downstreamnt
atgcagcgccgcgttcccacgtcgctcctgcgctgcatgcagcagcgcggcatctcgagc
tcgtccagccgccaatgggaccaagtgcgcccgcatttccacgccggggcgcacggcaac
ccgaagctaaacctgccgcagactgtgtcaattatcggcgcccccatgacgtacggccag
ccactgctgggcacggacggcggtccagatctattgcgcgaggctggattacacaagact
ttggtagacttgggctggtctgtagaggagaacggtaacctcaacttcgtggcgccatcc
tctaacgatccgacgctcgactcacgctacggcaaagccaagcagtgctttcctgttggc
aacggcacgaagcagttgtacgagactttcaagcaaaaagcaggggagggcaagttctgt
ttggtgttgggtggtgaccacactattggagctggatcccttgcaggattgctgtctgtg
caccctgacgcgggcgttatctgggtagatgcccacgcggacatcaacacgccggcggac
tcggagtctggcaacatgcacggtatgccaatcgccttcctcatggacggtatggtggac
agctccaagattccaggcttcgagtggctcagtaatggccccaagatgaagccggagcag
ctcgtgtacgtcggtctgcgcgacgtcgactcgttcgaacgtcgcgtcatccatgagaag
ggaattaaggcgttctctatgcaagaagtggaccgctacggtattggcaagacgatggag
atggcgctggaccatctttgtggcaagaagcagcggcctttgcacatgagctacgatatc
gacgcagtggacccactggtggctccctcgacaggcacacgtgtacgtggtggccttacg
tggcgtgaggctcattacgtcgctgaagctgtggcggaaaccaacttgatggtgggtctg
gacatggtcgaagtgaacccgacgctggcacctggcgatggagctcagattacggtcgac
atggcgctcatgctcatctcgtcggcgctcggaaaccgcatcttgtaa

DBGET integrated database retrieval system