KEGG   Phytophthora infestans: PITG_05850Help
Entry
PITG_05850        CDS       T01333                                 

Definition
(RefSeq) pterin-4-alpha-carbinolamine dehydratase
  KO
K01724  4a-hydroxytetrahydrobiopterin dehydratase [EC:4.2.1.96]
Organism
pif  Phytophthora infestans
Pathway
pif00790  Folate biosynthesis
pif01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pif00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    PITG_05850
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:pif04147]
    PITG_05850
Enzymes [BR:pif01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.96  4a-hydroxytetrahydrobiopterin dehydratase
     PITG_05850
Exosome [BR:pif04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   PITG_05850
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pterin_4a
Motif
Other DBs
NCBI-GeneID: 9472043
NCBI-ProteinID: XP_002998089
UniProt: D0N5U4
AA seq 104 aa AA seqDB search
MSTRAIPTLLTEEQRTAAFQQITSAWEEVPHRDAIRRKFEFRDFNEAWGFMNRTALLAEQ
MGHHPEWFNVYNRVDVTLSTHDCGGLSQNDIDMAIAMNSYAQAL
NT seq 315 nt NT seq  +upstreamnt  +downstreamnt
atgtctacacgcgccattccgacgcttctgacggaggaacaacgtaccgctgctttccag
cagatcaccagcgcctgggaagaggtgcctcaccgtgacgccattcgccgcaaattcgag
ttccgtgacttcaacgaggcctggggcttcatgaaccgaacagcgctgctagccgagcaa
atgggccaccacccggagtggtttaacgtgtacaaccgtgtggacgtgacgctcagcacc
cacgactgcggcggtttgtcccagaacgatattgacatggccatcgccatgaacagctac
gcccaggcgctgtga

DBGET integrated database retrieval system