KEGG   Phytophthora infestans: PITG_06108Help
Entry
PITG_06108        CDS       T01333                                 

Definition
(RefSeq) dihydrolipoyllysine-residue acetyltransferase component of pyruvate dehydrogenase complex, putative
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
pif  Phytophthora infestans
Pathway
pif00010  Glycolysis / Gluconeogenesis
pif00020  Citrate cycle (TCA cycle)
pif00620  Pyruvate metabolism
pif01100  Metabolic pathways
pif01110  Biosynthesis of secondary metabolites
pif01130  Biosynthesis of antibiotics
pif01200  Carbon metabolism
Module
pif_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:pif00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    PITG_06108
   00020 Citrate cycle (TCA cycle)
    PITG_06108
   00620 Pyruvate metabolism
    PITG_06108
Enzymes [BR:pif01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     PITG_06108
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl S36_mt QRPTase_N
Motif
Other DBs
NCBI-GeneID: 9472264
NCBI-ProteinID: XP_002998293
UniProt: D0N6E8
AA seq 438 aa AA seqDB search
MLRLSRSLLSAERRVVPLLRRAFSSLPESVSPLTMPSLSPTMETGSLSAWLRKEGEEVHA
GEVLCQVETDKAVVDYEMQDDAVVAKIICPEGSADLPIGALLAYTVEDMDTYKQLLDSGA
LANLSAEAPSATEPVAESKPEPTPASTTPAAESSHSGRVPLIKFLGKRSLLPEFNHSPLE
EAAKSASAAPAAQSVATSTVAADAEYEDLPLSNMRKIIAKRLAASKQEVPHSYTSIDCEI
DSILKFRKHLKTKHDVKVGMNDFILKAVALALRDVPEAICFFDVKTQSVQPNASVDVSVA
VATPTGLITPIVPKVDTLGLSRVNSIFMELVTRARQNKLKPEEFQGGSFTVSNLGSFGID
QFRAVINPPQACILAVGGGRKEVLPPLEIVEGVNPEPRIATLMNVTLSSDRRVVDGVIAG
QFLQAFKAYMENPELMVL
NT seq 1317 nt NT seq  +upstreamnt  +downstreamnt
atgttgcgtctgagccgctcgctgctgtcggccgagcgtcgcgtggtgcctctgctgcgt
cgcgccttctcgtctcttcccgagagtgtgtcccctctgacgatgccgtcgctgtcgccc
actatggagacgggctcgctgtccgcgtggcttagaaaagagggcgaggaagtgcacgct
ggcgaagttttgtgccaagtggagacggacaaggccgtcgtggactacgagatgcaggac
gacgctgtggtggctaagatcatttgcccagagggctcggctgaccttcccattggtgcg
ttgctcgcctacactgtggaggacatggacacgtacaagcagctgctagacagcggcgcg
cttgccaatctctcggccgaagctccttccgccactgagcctgtggctgagtctaagcct
gagcctactcctgcttctactacacctgctgcagagtcgagccacagtggccgcgtgccg
ctcattaagttcttgggcaagcgctcgctgcttcctgagttcaaccactcgcctcttgag
gaggctgcgaagtccgcaagcgctgctccagccgcgcagtctgtggccacgtccactgtc
gctgcggacgctgagtacgaggacttgccgctgtctaacatgcgcaagatcatcgcaaaa
cgcctggccgcctccaagcaggaggtgccgcacagctacacgagcatcgactgcgagatc
gacagcattttgaagttccgcaagcatttgaagaccaaacacgacgtcaaggtcggtatg
aacgactttatcctcaaggctgtggcgctagcgctgcgtgacgtgcccgaggccatctgc
ttcttcgatgttaagacgcagagcgtgcagcccaatgcgtcggtggacgtgtcggtggct
gtagctactccgacgggtctcatcacccccattgtgccaaaagttgacactctgggactc
agccgcgtcaacagcatatttatggagctcgtgactcgcgcgcgtcaaaacaaactcaag
cccgaggagttccagggcggctccttcactgtgtccaacctcggcagcttcggtatcgac
cagttccgcgctgtgatcaacccgcctcaggcctgcattctcgccgtgggtggcggtcgt
aaggaggtcctgccgcctctggagatcgtggagggcgtcaacccggagccgcggatcgcc
acgctcatgaacgtgacgctgtcttcggaccgtcgtgtggtggacggcgtcattgccggt
cagttcctacaggcgtttaaggcttacatggagaacccggagcttatggtcctgtaa

DBGET integrated database retrieval system