KEGG   Phytophthora infestans: PITG_07062Help
Entry
PITG_07062        CDS       T01333                                 

Definition
(RefSeq) aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B
  KO
K02434  aspartyl-tRNA(Asn)/glutamyl-tRNA(Gln) amidotransferase subunit B [EC:6.3.5.6 6.3.5.7]
Organism
pif  Phytophthora infestans
Pathway
pif00970  Aminoacyl-tRNA biosynthesis
pif01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pif00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    PITG_07062
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:pif03029]
    PITG_07062
Enzymes [BR:pif01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.6  asparaginyl-tRNA synthase (glutamine-hydrolysing)
     PITG_07062
    6.3.5.7  glutaminyl-tRNA synthase (glutamine-hydrolysing)
     PITG_07062
Mitochondrial biogenesis [BR:pif03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    PITG_07062
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: GatB_N GatB_Yqey
Motif
Other DBs
NCBI-GeneID: 9464025
NCBI-ProteinID: XP_002905028
UniProt: D0N761
AA seq 574 aa AA seqDB search
MAQVAANGARQPLLQLLRGPSGKLWEVCIGLEVHAQVLSRSKLMSGSAASTLSSARPNRN
VSFFDAALPGTLPVINRECVHQAIRMGLAVDATVHPRSLFERKHYFYCDLPLGYQLTQQR
APVASGGALHFELPESAVVSEHGGAHSDEATFDASKYKSRKEKNEALKKWKAKQAKKQQD
VISRSVRITRIQIEQDSGKSNHDLEDDSTVVDLNRAGTALLEIVMEPDLRSPVEAGQVMR
QLQHLLRHLDVCDGNMEEGSMRCDLNVSVRPTNLGAEADVESLHNALTARTAAPFGERVE
VKNMNSIRNMMRAAEYEARRQIALIEEEGGEVHRETRSFDAVTGETKRMRSKEGAKDYRF
FPEPDLPPLVFSEKLIQEISERMPELPEALKERLCAQYDLTSYESLVLVNEPGAAPYFET
VAAQNSRPSKVVVNWVLNDLFGHLKAVNGDIASSPVTATELGALIDLIQDGTISGKIAKD
VLELMFYENEPKKTPLQIVEEKGWKQIQDPEEIRALCRAVLDDPKAKKNLDAYWKGKTQL
FGFFIGQVMKQCGGRVHPELANSIMQEILEEHKQ
NT seq 1725 nt NT seq  +upstreamnt  +downstreamnt
atggctcaagtggcagctaatggcgcccgtcagccgctgctgcagctactgcgaggtccg
agcggcaaactttgggaggtctgcattggtctagaggttcatgcgcaggtgctgagccgc
tccaagcttatgagcggctccgcagcgtccacactgtcgtctgcacgacccaatcgcaac
gtcagcttcttcgacgcggcgctaccaggcacgctgccagtcattaaccgtgaatgcgtg
caccaagccatccgcatgggtctcgcagtggacgccacggtgcatccgcgcagtttattc
gagcgtaaacactatttctactgcgatctgccactgggataccagttgacacaacagcgg
gcgccagtagcgtctggaggtgcgctgcacttcgagttgccagaatccgccgtggtaagt
gaacacggaggtgcacatagtgacgaggccacattcgatgcgtctaagtacaagtctaga
aaagagaaaaacgaggcactgaagaagtggaaagccaaacaagccaagaagcagcaggat
gtgatctcgaggagtgtacgtatcacacgaattcagattgagcaggactcgggtaaaagc
aaccatgacttggaggatgacagtacagtagtggacctgaaccgtgctggtacggcgttg
ttggagattgtgatggagccggaccttcgcagtcccgttgaagcgggccaagtcatgcgt
caactgcagcatctactgcgtcatttggacgtgtgcgatggaaacatggaggaaggctct
atgcgttgtgatttaaacgtaagtgtgcggccgacgaaccttggagcggaggccgatgtg
gagtcacttcacaacgccctgacggccagaactgctgctcctttcggagagagagtggag
gtgaagaacatgaacagtatccgcaacatgatgcgagcagcagaatacgaagccaggaga
caaatcgcgttgattgaagaggaaggcggtgaggtgcatcgggagacgcgctcgttcgat
gctgtcactggagaaaccaaacgtatgcgttcaaaggagggggccaaggactatcgtttc
ttccccgagccagaccttcctcctcttgttttctcggagaaacttatccaggagatcagt
gagaggatgcccgaactccctgaagcactgaaagagcgtctatgtgcacagtacgatctc
acgtcgtacgaaagtttggtgctggtgaacgagcctggagctgcgccctacttcgagaca
gttgcagctcagaactctcgaccttccaaggtggttgtgaactgggtgctgaacgattta
ttcggacacttgaaggcagtcaacggcgacattgccagctctcccgttacagctacggag
cttggcgcattgattgatctcattcaggacggtacgatctctggtaagatcgccaaagac
gtattagagctcatgttctacgagaacgagccgaagaagacaccattgcagattgtggag
gagaagggatggaagcagattcaagaccccgaagagatccgtgcactctgccgagctgtg
ctcgatgacccaaaagcgaagaagaacctggacgcgtattggaaaggaaagactcagctc
ttcggcttctttatcggtcaggtgatgaagcaatgtgggggtcgggtgcatccagagctt
gcaaacagcatcatgcaggagatcctggaggagcacaaacaatag

DBGET integrated database retrieval system