KEGG   Phytophthora infestans: PITG_08358Help
Entry
PITG_08358        CDS       T01333                                 

Definition
(RefSeq) protein kinase, putative
  KO
K07359  calcium/calmodulin-dependent protein kinase kinase 2 [EC:2.7.11.17]
Organism
pif  Phytophthora infestans
Brite
KEGG Orthology (KO) [BR:pif00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:pif01001]
    PITG_08358
Enzymes [BR:pif01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.17  Ca2+/calmodulin-dependent protein kinase
     PITG_08358
Protein kinases [BR:pif01001]
 Serine/threonine kinases: Other
  CAMKK family
   PITG_08358
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase PP2C Pkinase_Tyr Kinase-like Pkinase_fungal RIO1 PP2C_2 APH
Motif
Other DBs
NCBI-GeneID: 9475054
NCBI-ProteinID: XP_002903750
UniProt: D0NAE7
AA seq 893 aa AA seqDB search
MSPTRSAGANMHIAAIPTSPIRQSSYRSGIVNNLVPAVVPLIMTGDQSPSKSAPSPGTSP
AASAIRDTKIVKKKRAELPQHNLPHPVPKFGDWLNSRTMINNYIILEPLGAGGYAEVKLC
KEKESGKLFAMKFISRDVMKKDKLGKQSKLDDIKREIAIMKKLNHPNVLRLYEVMDDPKM
NKLFLVLEYMKHGDMLSFQKKKNPLGTLENLRDRDLHSVFLQVILGLAYLHEQKIVHGDI
KPQNLLVGDKDVVKIADFGISQSLYGSKQKIADVAGTPAFMSPEMCSGEEYSGQLADVWA
LGATIFMLKFGNPPFLAKSAMQMFEKIQNDPLVFPAAIDPSLSHLLNGMLTKSPQKRLTL
LDVMVHPWVTKNEKHKLTLPSRPITVSKDEIEHAVGANHIAIAVNVRKQMRKRLKRARES
LEAKKNTTTDSNIVFAQSPKSIDFKKFAKTSKIFADDAPSGARRVLSSEEIDYRSQLFSR
KKASNKNTLEALPPSGEHTVTHPMNDSLDDEDVFSDDDDELAVSQSPQLLDELLLTTLSM
PPLANTTNQHRSRCNTTSKELSSGSPCIVNRTSYLSTDKSAIEGHDALCFDGQSPTLAVR
YGVSSLQGRRSTQEDRWVVLSCLATTLGNAVWADTAFIGIYDGHGGEECANILHDQLHTW
IFKSPDAALTEKSLQDCFESLDASVCDYLLHKDDLSGSTATGLVLRPGTNGKIVLTIAHV
GDCRLVLSKRDGTTVELTQDHRLTLEVERERVIQRGGRVVNNRVNGVMAITRAFGDLEFK
GMLNQHPANAGGSSGFGRAFRDTCNEKVPALLTASPDVHELQLNPRDDAFLLLACDGLWD
VLTSEEATAIFRERVELHGDLQLAAHELAQEGIRRYSNDNITVIAVLLEPPTS
NT seq 2682 nt NT seq  +upstreamnt  +downstreamnt
atgtccccaaccagaagcgcaggggcaaacatgcatattgccgcgatccctacgtcccca
atcagacagtcgtcctaccgttcaggtatcgtcaacaaccttgttccggctgtcgtccca
ctcattatgactggcgatcagtctcctagtaagtctgcgccatcgcctggcacttctccg
gctgcgtctgccattcgagacacaaaaattgtgaagaagaagagagcagagttacctcaa
cacaatttgcctcatcccgtcccgaagtttggcgattggctcaactcccggaccatgata
aacaactacattatcttagaacctctgggtgcgggagggtacgccgaagtgaagctctgc
aaggaaaaagaatccggtaagttattcgccatgaaatttatcagtcgcgacgtcatgaag
aaagataaactgggcaagcagagcaaactggacgacatcaagcgcgagattgccatcatg
aagaagctcaaccatccgaacgtgttgcgtctatacgaagtcatggacgaccccaagatg
aacaaacttttccttgttctcgagtacatgaagcacggcgacatgctctcgttccagaag
aagaaaaacccactggggacgctggaaaacttgcgagatcgagaccttcacagtgttttc
ttacaggtcattttgggcctagcctatctgcacgaacaaaaaattgtacacggagatatc
aaacctcagaatcttctggttggcgacaaagatgtcgtgaaaatcgcagacttcggcatc
tcccagtcgctctacggtagcaaacagaagatcgcagatgtagcgggtacacccgccttt
atgtcgcccgagatgtgctcgggtgaggagtattcaggccaactcgctgacgtttgggct
cttggagcgacaatcttcatgcttaagttcgggaaccccccgttcttggctaaaagtgcc
atgcaaatgttcgagaagatccagaatgatcccttagtgttcccagctgcaatcgaccca
tctctatctcatttactcaacgggatgctcacgaaatccccacagaagcgtctgacgctt
ctagatgtcatggttcacccctgggttaccaagaatgaaaagcacaaactgactctgccg
tcgcgtccgatcacagtgtcaaaagacgagatcgagcatgcggtcggtgcgaatcacatc
gcgatcgcggtgaacgtccgcaagcagatgcgtaagcgtctcaaacgtgctcgagagtct
ctggaagcgaagaaaaacacgacaacagactcgaatatcgtgttcgcacagtcgccaaag
tcgattgatttcaagaaattcgccaaaacgagcaaaatctttgcagacgatgcgccatcg
ggcgcgcgtagagttctctcgagtgaagagatcgattaccgttcgcaacttttttctcga
aagaaagcaagcaacaagaacacgctggaagctctcccgcccagtggagagcacacggtg
actcaccccatgaacgatagtcttgacgacgaagacgtgttttcggatgacgacgacgag
ctggcagtgtcccagtcgccacaactactcgatgaattactactcaccacgctctccatg
ccgcctttagcaaataccacgaatcagcatcgaagcagatgcaatactaccagtaaggaa
ctgtcgagtggatctccgtgtatcgtcaatcgaacatcgtacttgagcacggataaaagt
gcaattgaaggccacgacgccctttgtttcgacggacagagtcccactctggctgttcgt
tatggcgtgtcatcgttacaaggccgacgtagcactcaagaagaccgatgggtggttttg
tcttgcctcgcgacaactctaggcaacgccgtgtgggcagataccgcgttcattggaatc
tacgatggccacggaggggaagagtgcgcgaatattttgcatgaccagctccacacttgg
atattcaagtcaccggacgctgcacttacagaaaaatccttgcaggattgctttgaatcg
ctcgatgcatccgtgtgtgattatttattgcacaaggacgatcttagtggttctacagcc
actggacttgtacttcgacctgggacgaatgggaagattgtattaaccatcgcacacgtg
ggagattgccgtcttgtattaagcaaacgcgacggtactacggttgagcttacacaagac
caccgtcttacactggaagtcgaacgtgaacgtgtaattcaacgaggtggacgtgtggta
aataaccgagttaacggtgttatggcgattacacgggcttttggagatctcgagttcaaa
gggatgctgaaccagcatccagcgaacgctggggggtcgtccggattcggtcgggctttc
cgtgatacatgtaacgagaaggtaccagcgttactcacggcgagtcctgatgtgcatgaa
ctgcagcttaacccgagagacgacgcattcttgttattggcttgcgatgggctctgggat
gttttgacgagcgaagaagctacggcgatttttagagaacgtgtggagctgcatggagat
ctccagctagcagcccatgaactggcgcaagagggaattcgacgatactctaacgacaac
ataaccgttattgcagttttactagagccaccaacatcgtaa

DBGET integrated database retrieval system