KEGG   Phytophthora infestans: PITG_08761Help
Entry
PITG_08761        CDS       T01333                                 

Definition
(RefSeq) nucleoside diphosphate kinase B
  KO
K00940  nucleoside-diphosphate kinase [EC:2.7.4.6]
Organism
pif  Phytophthora infestans
Pathway
pif00230  Purine metabolism
pif00240  Pyrimidine metabolism
pif01100  Metabolic pathways
pif01110  Biosynthesis of secondary metabolites
pif01130  Biosynthesis of antibiotics
Module
pif_M00049  Adenine ribonucleotide biosynthesis, IMP => ADP,ATP
pif_M00050  Guanine ribonucleotide biosynthesis IMP => GDP,GTP
pif_M00052  Pyrimidine ribonucleotide biosynthesis, UMP => UDP/UTP,CDP/CTP
Brite
KEGG Orthology (KO) [BR:pif00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    PITG_08761
   00240 Pyrimidine metabolism
    PITG_08761
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:pif04131]
    PITG_08761
Enzymes [BR:pif01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.6  nucleoside-diphosphate kinase
     PITG_08761
Membrane trafficking [BR:pif04131]
 Exocytosis
  Calcium ion-dependent exocytosis
   Kinases and associated proteins
    PITG_08761
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: NDK
Motif
Other DBs
NCBI-GeneID: 9461730
NCBI-ProteinID: XP_002902842
UniProt: D0ND55
AA seq 221 aa AA seqDB search
MSRRVASAAKRSATRTFTTQARAASAVKAPVLAVAAAAGVTALALSAAPVAENKAAVQSS
TPLGGVPGTSKERTFIAIKPDGVQRGLISEVIGRFEKKGYKLVALKLMTATEARAKAHYA
DLSERSFFPGLVKYFTSGPIVCMVWEGTDVILTGRKILGATNPNQAAPGTLRGDNCISTG
RNLVHGSDGPDSAKHEITMWFTPEEASNYERALDTWIVSDN
NT seq 666 nt NT seq  +upstreamnt  +downstreamnt
atgtcccgccgtgtcgcctccgccgccaagcgcagtgccacccgcaccttcaccacccag
gctcgtgccgcttcggccgtgaaggccccagttcttgctgtggctgccgctgctggtgtg
acggccctggccctgagcgctgcccccgtggctgagaacaaggctgctgtccagtcctcg
acgcctctgggtggcgtgcccggaacctccaaggagcgcacgttcattgccattaagccc
gatggcgtgcagcgcggtctgatcagcgaggtgatcggccgcttcgaaaagaaaggctac
aaactcgtggcgctaaagcttatgaccgccacggaggctcgcgccaaggcccactacgcc
gacctgtcggagcgttctttcttcccgggtctcgtcaagtacttcacctcgggccccatc
gtgtgcatggtgtgggagggcacggacgtgatcctcaccggccgcaagatcttgggcgcg
accaaccccaaccaggctgcccccggcactctgcgtggcgacaactgcatctccacgggc
cgcaacctcgtgcacggctcggacggccccgactcggccaagcacgagatcactatgtgg
ttcacccccgaggaagccagcaactacgagcgtgcccttgacacgtggatcgtttcggac
aactaa

DBGET integrated database retrieval system