KEGG   Phytophthora infestans: PITG_09432Help
Entry
PITG_09432        CDS       T01333                                 

Definition
(RefSeq) nucleolar protein NOP5
  KO
K14565  nucleolar protein 58
Organism
pif  Phytophthora infestans
Pathway
pif03008  Ribosome biogenesis in eukaryotes
Brite
KEGG Orthology (KO) [BR:pif00001]
 09120 Genetic Information Processing
  09122 Translation
   03008 Ribosome biogenesis in eukaryotes
    PITG_09432
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03009 Ribosome biogenesis [BR:pif03009]
    PITG_09432
Ribosome biogenesis [BR:pif03009]
 Eukaryotic type
  Sno RNPs
   Box C/D snoRNPs
    PITG_09432
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Nop NOP5NT
Motif
Other DBs
NCBI-GeneID: 9462548
NCBI-ProteinID: XP_002903084
UniProt: D0NBZ5
AA seq 519 aa AA seqDB search
MESSKQVRKYRATRKEINTSLDTMLVLFETAAGHALFKVQDEAKLANADDVFKHFSTPEK
AAKVLKLKGFNAFKDTTEAVAAATDMVDGKMGKTLKKFLKKNVVDVGLKDKLAVSDKALG
SLIKEKLSIACVNDSAVNEVMRGIRANMDTLITGLEDDDLKAMTLGLSHSLSRYKLKFSA
DKVDTMIVQAIGLLDELDKEINTYSMRVREWFGWHFPEMGKIVTDNLQYAKCVLKMGMRT
QVKSLDFSDILSEDVEASMREVCEVSMGTDISEEDVTNISALCEQVISLTEYRAQLFDYL
KNRMNAIAPNLTVMVGELVGARLIAHAGSLMNLAKHPASTVQILGAEKALFRALKTKHDT
PKYGLIYHASLIGQTAPKHKGKISRVLAAKTALAVRVDALGDSTEATIGFDNRAKVEARV
RQLENGFSGVPNSNGKTKNESKKYVKTETSKSYNADADMTVSSKKRKAEAADDEDEEPKV
KKEKKDKKHKKKKSADDDAEVKEDKKDKKKKHKKKKSAE
NT seq 1560 nt NT seq  +upstreamnt  +downstreamnt
atggagagctctaagcaagtgcgtaaatatcgagcaaccaggaaggagataaacacttcg
ctagatacgatgctggttctgttcgagactgccgcaggtcacgcgctgttcaaggtgcag
gacgaggccaagctggccaacgccgatgacgtcttcaaacacttttcgacgcctgagaag
gccgctaaggtgctgaagctcaagggtttcaatgcgttcaaggacacgacagaagctgtg
gccgctgccaccgacatggtggacggcaagatgggcaagacgctcaagaagttcctcaag
aagaacgtggtggacgttggtcttaaggacaagctggctgtgtcggacaaggctctgggc
tcgctcatcaaggaaaagctcagcatcgcctgtgttaacgacagcgccgttaacgaggtg
atgcgtggcatccgtgccaacatggacacgctcatcacgggtctggaggacgacgacctg
aaggctatgacgctgggtctgtcgcactcgctgtctcgttacaaactcaagttcagcgct
gacaaggtggatactatgattgtgcaggccattggtctcttggacgagctggacaaggag
atcaacacgtactcgatgcgtgtgcgcgagtggtttggatggcacttcccagagatgggc
aagatcgtcacggacaacctgcagtacgccaagtgtgtgctcaagatgggcatgcgcacg
caggtgaagagtctggacttctcggacatcctgtcggaggacgttgaggcctcaatgcgc
gaggtctgcgaggtgtccatgggtacggacatctccgaggaagacgtgaccaacatctcg
gctctgtgtgagcaggttatctccctcacggagtaccgtgctcagcttttcgactacctg
aagaaccgtatgaacgctatcgcccccaacctcaccgtgatggttggtgaactggtcggt
gctcgtctcattgcccatgctggctcgctgatgaacctggccaagcacccggcgtccacc
gtgcagattcttggagctgagaaggcgctgttccgtgccctcaagaccaagcacgatacc
cccaagtacggtctgatctaccacgcttcgcttattggccagactgcccccaagcacaag
ggtaagatctctcgcgtgctggctgctaagacggcgctagctgtgcgtgtggacgctctg
ggcgactccacggaggccacgatcggttttgataatcgcgctaaggtggaggctcgtgtg
cgtcagctggagaatggattttcgggtgtgcccaacagcaacggcaagacgaagaatgag
tccaagaagtacgtcaagacggagacgagcaagtcgtacaacgcggacgctgacatgact
gtgtcgagtaagaaacgtaaggcggaggcggctgacgacgaggatgaagagccgaaggtc
aagaaagaaaagaaagacaagaagcacaagaagaaaaaatccgctgacgacgacgcggag
gtgaaggaggacaaaaaggacaaaaagaagaagcacaagaagaaaaaaagcgcggaatag

DBGET integrated database retrieval system