KEGG   Phytophthora infestans: PITG_09671Help
Entry
PITG_09671        CDS       T01333                                 

Definition
(RefSeq) receptor-type tyrosine-protein phosphatase, putative
Organism
pif  Phytophthora infestans
SSDB OrthologParalogGFIT
Motif
Pfam: Y_phosphatase DSPc
Motif
Other DBs
NCBI-GeneID: 9470304
NCBI-ProteinID: XP_002903282
UniProt: D0NCJ2
AA seq 341 aa AA seqDB search
MDAPATPSPAADSGIASLRSALAEKNSLPSTTSVAIDAFLATTQRLQHRGRRSGASGFER
EYMELCWSIDKAPGYEAALTLQTKATKAKNRYLDVLPFEKTRVKLQAASAQPGDDYINAN
YIDGGYIACCAPVPAAIRDFWHMVWQCDVHVVLMLTNFVESERRKADLYWDPRGKTVAFD
SLHVQLMEEQHPTSLGFIVRKLKVWKDGSGESRVVQHIQLTTWPDHGVLRDFRVVAPMLD
AVNSYRDEASRRYKVDARVVVHCSAGIGRSGTFIAIDILLKQLRQALMDTADSAETMKQA
LDIPRVVYSLRSQRPGMVQTPGQYQMIYQYLAAVVSDNQPW
NT seq 1026 nt NT seq  +upstreamnt  +downstreamnt
atggacgcaccggccactccgtctcctgctgctgacagcggcattgcgtcgttgcggagt
gctctagctgaaaagaatagcctcccgtcgaccaccagcgtcgctatcgatgcgtttctg
gccacgacgcagcgactacagcatcggggcagacgttcgggcgcctcaggcttcgaacgg
gagtacatggaactctgctggagtatcgacaaagcgccaggctacgaggcagcgctgact
ctgcagactaaagctaccaaggccaaaaaccggtacctggacgtgcttccgttcgaaaag
acgcgggtgaagctacaagcagcgtctgcgcaaccaggagacgactacattaacgccaat
tacattgacggaggctacatcgcctgctgtgcaccggtacctgcagccatccgcgacttc
tggcacatggtgtggcaatgcgacgtgcacgtagtgctcatgctcacgaactttgtcgaa
agtgagagacggaaagccgacttgtactgggacccacgaggaaagactgtggcctttgac
agcctgcacgtccagctgatggaagagcaacatcctacgagcttggggttcattgtcaga
aagcttaaggtctggaaggatgggagcggagaaagccgcgtcgttcagcacattcagctg
acgacgtggcccgatcacggtgtgttacgtgacttccgagtagttgcaccaatgctcgat
gcagtcaacagctaccgtgacgaggcatcgaggcgctataaggtggatgcgagagttgtg
gtgcactgtagtgccggcattggacgctccggcacgttcatcgccatagatattctgttg
aagcagctgcgtcaagctctgatggatacagcggatagtgctgagacgatgaagcaggct
ctggacatcccgcgagtcgtctacagtctgcgatctcaacgacctggcatggtacaaacc
ccgggacaatatcaaatgatctaccagtatttagctgccgtggttagcgacaatcaacct
tggtga

DBGET integrated database retrieval system