KEGG   Phytophthora infestans: PITG_10305Help
Entry
PITG_10305        CDS       T01333                                 

Definition
(RefSeq) peroxisomal acyl-coenzyme A oxidase, putative
  KO
K00232  acyl-CoA oxidase [EC:1.3.3.6]
Organism
pif  Phytophthora infestans
Pathway
pif00071  Fatty acid degradation
pif00592  alpha-Linolenic acid metabolism
pif01040  Biosynthesis of unsaturated fatty acids
pif01100  Metabolic pathways
pif01110  Biosynthesis of secondary metabolites
pif01212  Fatty acid metabolism
pif04146  Peroxisome
Module
pif_M00087  beta-Oxidation
pif_M00861  beta-Oxidation, peroxisome, VLCFA
Brite
KEGG Orthology (KO) [BR:pif00001]
 09100 Metabolism
  09103 Lipid metabolism
   00071 Fatty acid degradation
    PITG_10305
   00592 alpha-Linolenic acid metabolism
    PITG_10305
   01040 Biosynthesis of unsaturated fatty acids
    PITG_10305
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    PITG_10305
Enzymes [BR:pif01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.3  With oxygen as acceptor
    1.3.3.6  acyl-CoA oxidase
     PITG_10305
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ACOX Acyl-CoA_ox_N Acyl-CoA_dh_M Acyl-CoA_dh_1
Motif
Other DBs
NCBI-GeneID: 9473938
NCBI-ProteinID: XP_002902123
UniProt: D0NF06
AA seq 622 aa AA seqDB search
MELKDLTPLLLQRERESSDVDVELLTNTLRGGHAANRDTAFQNHTQRYVKLIQSGKVDSD
AQQIMYDVIGEKLPIQVHRSMFNPTLENQADDEQQAHWLPLATSYRILGAYAQTELGHGS
NVQGLETTAVYDKGKQEFVINSPSLTSRKWWPGGLGKTATHAVVHAQLRIDGVHHGAQAF
IVPLRSLKDHKPLPGVEVGDIGPKVGFNSLDNGYAVFHSVRIPRRNMLMRFAKVLPDGTF
IKPPSSKLVYLTMTQIRAYLILKLGLALGAATTIATRFSAVRAQGRKVSDNNLTLTSETP
VLDYQNPQHALLPLVALSYAANFAGRSMVDMHDKVLAMVTSGQSDFATQSAQLHAISSGL
KGWLADRVNDGIEHCRRLCGGHGFLQSSNLAHLFAETAGSCTYEGTADVLVQQHARYLLK
ELSSIATAQNEQFVGFLSRSDYYSSPKLRCRAKSSADLGSLKVLIEAFEVRAARSIRNLS
RAMKKSNDNANACMVLMTAASTHHTELLLLKWFIAGAALLPVGTTKNAVTQLCQLFGVWL
LVNGLGNFRHDGYFSSAQADMAHHQLAAMLPLVRQNVVRLTDGWNFSDFELNSTLGCFDG
DIYRSSPDGYDKYLRPLIQSSL
NT seq 1869 nt NT seq  +upstreamnt  +downstreamnt
atggagctgaaagatctgacacctctgctgctgcagcgcgaaagagagtcgagtgatgtg
gatgtcgagttgctgacaaacactctccgtggtggccatgctgccaaccgagacacagcc
tttcaaaatcacacgcagcgatacgtgaagctcatccagagcggtaaagtggacagtgac
gcccagcagatcatgtacgatgttattggcgagaagctcccgatccaagtacaccgctcc
atgttcaacccgactttagagaaccaagcggacgacgagcaacaagctcattggctgcct
ctcgccacgtcgtatcggatccttggagcctacgcacagacggaattgggtcacggctcg
aacgtacaaggtctagagaccacagctgtctacgataaggggaaacaagagttcgtcatc
aactccccctctttaacgagtcgcaaatggtggcctggagggctaggaaagactgccacg
catgccgttgtgcacgcacagctccgtattgacggtgtgcaccacggtgctcaagcgttc
attgtccctctacgctctctaaaagaccacaagccgctacctggtgtggaagtgggtgat
atcggtccaaaagtgggttttaattcactcgataatgggtacgctgtgttccacagcgtg
agaattccacgacgaaacatgctcatgcgctttgccaaggtgttaccagatggaacattt
attaaaccgccgagttccaagctcgtatacctcactatgacacaaattcgcgcgtacttg
atcctcaagctcgggctcgctcttggagctgccacgaccatcgccacccgcttcagtgct
gtccgtgctcaaggacgtaaagtaagtgataataacctcacgttaacgagcgagaccccg
gtgctggactaccagaacccgcaacacgctctgctgccattagtggcgctatcctacgca
gccaatttcgctggacggtcaatggttgacatgcacgataaagtgctagctatggtcacc
agcggtcagagcgatttcgctactcagtcggctcagctacacgccatctcgtccggatta
aaagggtggctagcggaccgtgtgaacgacggcatcgaacactgtcgtcgtctctgtgga
ggccacggtttcttacagagtagcaatctggcgcatctcttcgctgagactgcgggatcc
tgcacgtatgaaggcacagccgacgtgctagttcaacaacacgctcgctatctgttgaag
gagttatcgagcattgccacggctcaaaacgaacagttcgtaggctttctaagtcgcagc
gactactactcgagcccgaagctacgatgcagagccaagagttcggcagatctcggtagc
ttgaaggtgctgatagaggcgtttgaggttcgagcagctcgctctattcgaaatctgtcg
cgtgcgatgaagaagtcaaacgacaacgcgaatgcgtgtatggtactgatgactgcagcg
tcgacgcatcacacggagttgttgctgcttaagtggtttatcgcgggagctgcattgttg
cccgtggggacgacaaagaatgccgtgacgcagttgtgtcagctttttggtgtttggctt
ctggtcaatggccttggcaacttccgtcatgacggctacttctcaagtgcgcaagcagat
atggcgcatcatcaactggcagcgatgttgccgctagttcgccagaatgttgtgcgattg
acagatggctggaactttagtgacttcgagctcaactcgacacttggttgcttcgatgga
gacatctaccgctcttccccggatggatacgacaaatatcttcgtccactcatccagtct
tcgctctaa

DBGET integrated database retrieval system