KEGG   Phytophthora infestans: PITG_11164Help
Entry
PITG_11164        CDS       T01333                                 

Definition
(RefSeq) hypothetical protein
  KO
K17623  pseudouridine 5'-phosphatase [EC:3.1.3.96]
Organism
pif  Phytophthora infestans
Brite
KEGG Orthology (KO) [BR:pif00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:pif01009]
    PITG_11164
Enzymes [BR:pif01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.96  pseudouridine 5'-phosphatase
     PITG_11164
Protein phosphatases and associated proteins [BR:pif01009]
 HAD phosphatases
  Other HAD phosphatases
   PITG_11164
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: HAD_2 Hydrolase HAD Hydrolase_6 Hydrolase_like
Motif
Other DBs
NCBI-GeneID: 9476325
NCBI-ProteinID: XP_002901931
UniProt: D0NGC0
AA seq 246 aa AA seqDB search
MTNAHHVQLKPKAHGVIFDMDGTLLDTEELSRLAIDGVVRQFGKEFTMPMHKTILGRPAV
EWTRMAITAAGLSEETIAPEELFKQWEKSMRDMSDRVKEIPGGIEVLTALHARGIPIALA
TSNSRNVVEAKIKHHPKLFSFFSTIVCGDDPAVKRGKPAPDIFRTAGQRLFGLKEGEDGD
KPPHCIVFEDSVNGYTAANAADMHSIAIPDVRIHTDEVQRAELFGEADEVITSLTQFQID
NYDWQL
NT seq 741 nt NT seq  +upstreamnt  +downstreamnt
atgacgaacgcccaccacgtgcaactcaagccgaaggcgcatggcgtcatcttcgacatg
gatggcacgctgctggacacagaggagttgagccgccttgccattgacggcgtagtgcgt
cagttcggaaaggaattcaccatgccaatgcacaagacaattctgggccgtcccgctgtc
gagtggactcgcatggccatcactgccgccggtctcagcgaggagaccattgctccagaa
gagctatttaagcagtgggagaagagtatgcgagacatgtcggaccgcgtcaaggagatt
ccgggaggcatcgaggttttgaccgccctacacgcacgtggtatccctatcgcgctggcc
acttccaacagcaggaacgtcgtggaggccaagatcaagcaccacccgaagctcttctca
tttttctctacgatcgtgtgcggtgacgacccagccgtgaagcgcggtaagccagcgccc
gatattttccgcaccgctggtcaacgtctctttgggctcaaggagggcgaggacggcgac
aagccaccgcattgcatcgtgttcgaggactcggtaaatggctacactgcagctaacgct
gcggatatgcatagtatcgctattcccgatgtacgcatccacacggacgaagtacagagg
gcggagctctttggcgaagcagacgaggtgatcacgtcgctcacccagttccagatcgac
aactacgactggcagctgtaa

DBGET integrated database retrieval system