KEGG   Phytophthora infestans: PITG_11605Help
Entry
PITG_11605        CDS       T01333                                 

Definition
(RefSeq) aldehyde dehydrogenase, putative
  KO
K00128  aldehyde dehydrogenase (NAD+) [EC:1.2.1.3]
Organism
pif  Phytophthora infestans
Pathway
pif00010  Glycolysis / Gluconeogenesis
pif00053  Ascorbate and aldarate metabolism
pif00071  Fatty acid degradation
pif00280  Valine, leucine and isoleucine degradation
pif00310  Lysine degradation
pif00330  Arginine and proline metabolism
pif00340  Histidine metabolism
pif00380  Tryptophan metabolism
pif00410  beta-Alanine metabolism
pif00561  Glycerolipid metabolism
pif00620  Pyruvate metabolism
pif01100  Metabolic pathways
pif01110  Biosynthesis of secondary metabolites
pif01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:pif00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    PITG_11605
   00053 Ascorbate and aldarate metabolism
    PITG_11605
   00620 Pyruvate metabolism
    PITG_11605
  09103 Lipid metabolism
   00071 Fatty acid degradation
    PITG_11605
   00561 Glycerolipid metabolism
    PITG_11605
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    PITG_11605
   00310 Lysine degradation
    PITG_11605
   00330 Arginine and proline metabolism
    PITG_11605
   00340 Histidine metabolism
    PITG_11605
   00380 Tryptophan metabolism
    PITG_11605
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    PITG_11605
Enzymes [BR:pif01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.3  aldehyde dehydrogenase (NAD+)
     PITG_11605
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Aldedh
Motif
Other DBs
NCBI-GeneID: 9470672
NCBI-ProteinID: XP_002901152
UniProt: D0NI53
AA seq 541 aa AA seqDB search
MPVPDLPGTPQIPASYIAVEDVNPSVDMYGSTTDIPPLPDVSKQDTHADVAALRASFATG
ATKDPKTRKSLLRALQRLVNENEAIINEAVWKDLHKHPLELFSTEVALLKAEIQDFIDYV
DDWSKPKLKTTNIVNLPGLSYIRPEPLGVVCVIGTWNYPINLLLMPLVAALGAGNCVVVR
LPGDDTTRFLNNVLIQLFDKYMDKRYVRLVYGGVEETKKMLQERYDLIFATGGNFLGKIV
AQAAAQYLTPTVLELGGKSPCIIDNTADLKLAAKRIAWGAFLNGGQTCVRPDYLLVDAKV
GDQFVKLLEGELDVQYGGANVKESDSYGRVINQRMHDRLVRILDKDRKHVVYGGDTDNKQ
RFISPTLLNFRTELDLFVSSASMGEEIFGPLLPIYYYTSGDLDEPITFVTAREKPLALYH
FSSNGKNKERVVNETSAGSMMLNDMLMQLSNAHVPFGGVGNSGMGAYHGHYGFEAFSHYK
SVIYKNGMLDLPQRYAPYTPSKKFILSIAMYPFSRLHMRLVKSLGFAAVLAIIAVIIRYS
V
NT seq 1626 nt NT seq  +upstreamnt  +downstreamnt
atgccagtccccgatctgccaggaaccccacagatcccagctagctatatcgcggtcgag
gacgtgaatcctagcgtcgacatgtacggatccactacagacatcccacctctgcccgat
gtgtcgaaacaggacacacacgctgacgtggctgccttgcgcgccagcttcgccacaggc
gccaccaaggaccccaagacgcgcaagtcactgctgcgagcgctgcaacgactcgtaaat
gagaacgaggctattatcaatgaggctgtatggaaggatctgcacaagcatccattggag
ctgttctccaccgaagtcgcactgctcaaagcggagatccaagactttatcgactatgtt
gacgattggtccaagcctaaacttaagactaccaacatcgtcaatctcccaggcctgtct
tacattagacctgagcctctcggcgtagtctgtgtcataggcacatggaactacccgata
aacctgctactgatgccgctggtagccgctcttggagctggcaactgtgtcgtcgtgaga
ctaccgggagacgacaccacgcgcttcctgaacaacgtgttgatccagctgttcgacaaa
tacatggacaagcgctacgtccgcttggtgtatggaggtgtcgaggagaccaagaagatg
ctacaagagcgctacgacctcatctttgccacaggcggcaattttctgggcaaaattgtg
gctcaagctgcggcacaatatttgacaccaacggtgttggagttgggaggcaagtctccg
tgtataattgacaacacagcggacttgaaattggctgcaaagcgcattgcctggggagca
ttcttaaacggaggacagacgtgcgttcgcccagactatttgctggtggacgcaaaagtg
ggcgatcagtttgtgaagctgctggaaggagaactggatgtgcaatacggtggtgccaac
gtgaaggagtcggacagctacggccgtgtaatcaaccagcgcatgcacgaccgcttggtg
cgcattctggacaaagatcgtaagcatgtggtctatggtggcgataccgacaacaagcaa
cgttttatttcaccaacgctgctaaacttccgcactgaattggacttattcgtgtcgagt
gcctccatgggcgaagagatctttggcccactgctgccaatctactactacacgtcgggc
gatttggacgagcctattacctttgtcactgcacgggagaaaccccttgcgttgtaccac
ttcagctccaatggcaagaacaaagagcgtgtagtaaacgagacatctgccggtagcatg
atgctgaacgacatgcttatgcagctctcgaacgcgcacgttccattcggtggtgttggc
aactctggcatgggcgcctatcacggccactacggatttgaggccttctcgcactacaag
tcggtgatctacaagaacgggatgctggatctaccacagcgttatgcgccgtacactcca
tcgaagaaatttatcctaagcatcgccatgtacccgttctctcgactgcacatgcggctg
gtcaagtctcttggcttcgctgcggtgcttgccatcattgctgtcattatcaggtactcc
gtctga

DBGET integrated database retrieval system