KEGG   Phytophthora infestans: PITG_13013
Entry
PITG_13013        CDS       T01333                                 

Definition
(RefSeq) nitrite reductase [NAD(P)H], putative
  KO
K17877  nitrite reductase (NAD(P)H) [EC:1.7.1.4]
Organism
pif  Phytophthora infestans
Pathway
pif00910  Nitrogen metabolism
pif01100  Metabolic pathways
Module
pif_M00531  Assimilatory nitrate reduction, nitrate => ammonia
pif_M00615  Nitrate assimilation
Brite
KEGG Orthology (KO) [BR:pif00001]
 09100 Metabolism
  09102 Energy metabolism
   00910 Nitrogen metabolism
    PITG_13013
Enzymes [BR:pif01000]
 1. Oxidoreductases
  1.7  Acting on other nitrogenous compounds as donors
   1.7.1  With NAD+ or NADP+ as acceptor
    1.7.1.4  nitrite reductase [NAD(P)H]
     PITG_13013
SSDB
Motif
Pfam: Pyr_redox_2 Pyr_redox Rieske_2 NIR_SIR Fer2_BFD NIR_SIR_ferr Rubredoxin_C Pyr_redox_3 Rieske AlaDh_PNT_C NAD_binding_8
Other DBs
NCBI-GeneID: 9474516
NCBI-ProteinID: XP_002900554
UniProt: D0NK32
AA seq 1046 aa
MAHANEVVVVVGNGMVGHRFLDRLRKYDTTKRFTVVSIGEEPIQHYNRMLLTEYFEHLSI
DKLKLAPPNWYVENGVDLITNTQALALDTKNKKLLCQRLSDDVPKQFEVPYDRVVIATGA
SALVPQLPGASLHGVFVYRSIADLNSIIAHAEKQAKLEATGSAKKYALVIGGGLLGLEAA
KAVHDLKLSVRIIDRGTRLMSRQLDADGAKVLHNEIVNKFGIDVLYEKSTQEIIGTEESG
VEAVEFTNGERFDNVCMVIFATGIKPRDELAHSSGLELAKRGGILINDYLECSEPYVYGI
GECISHRDVTYGLVAPGYEMADTLAKNLTCGSPENRIAFPGGDVSTKLKLMGMEVGSFGD
YFPEFISEPFEVLTYNNPLENVYKKLFFSVDASKLLGGILVGDTSDFVRLSLMFKQKDTK
PLVDPPNEILLKKRGGGSSTVLDLPDEAQVCSCNNVSKGDICQAIKEKKLTKLGDVKKVC
NVGTGCGGCMPMVKDILEAELAAAGAEVDKSLCEHFAYSRQELYQIIQVEQYATFAEVLA
KHGRKQHAPRSYGCEICKPTIASILASLQNGHILKGDRAALQDSNDRFLANLQKSGQFSV
VPRVAGGEITPDKLIVLGQVAKRFDLYTKITGGQRVDLFGAQKQDLPEIWRMLVHAGFES
GHAYGKSLRTVKSCVGTTWCRYGQQDSVGFAVFLENRYRGIRSPHKLKGGVSGCTRECAE
ARSKDFGCIATDQGYNVYVGGNGGTNPRHATLLASDVPQELAVKYLDRYIMYYIMTADRL
QRTSKWLDALEGGIEQLRRVVMEDSLGICATLEKQMSYLVGTYECEWKKVIESPELLAQF
AQFKNTNETQKEVQMKTVRDQRMPTFVAHAKTGSSGTGTESSSPASTTSVLSDLDETEWV
SFGSKDLFDMNSGGAVLYGESQLAIFNITESCNGIEKVSWYATQNMCPYDHSFVLAQGIV
GDLDGRPKVACPMHKCNFDLSDGCCLSGNDFRLQTFDAKEEEGIIYVLLPPVDAIDARLA
TSKFIAKDRDVSVLPVVSKAPVTLDW
NT seq 3141 nt   +upstreamnt  +downstreamnt
atggcacacgccaacgaggtggtcgtggttgtggggaacggcatggtaggtcaccggttc
ctggatcggctccgcaagtacgataccaccaagcgcttcaccgtcgtttctataggagag
gaacccatccaacactataaccgcatgctgttaaccgagtactttgagcatctgagtatc
gataaactcaagctggcgccacccaactggtacgtcgagaatggagtcgacctcataacg
aacacacaagctttggcactagacacgaagaacaagaagttgctatgccagcgactcagt
gacgacgtaccaaagcagttcgaggtgccgtacgaccgtgtcgtgatcgccacgggtgcg
agtgcattggtgccacaacttcctggtgcgagcctgcacggtgtgttcgtgtaccgctcc
atcgccgatctcaacagcatcatcgcccacgctgagaagcaagccaaactggaggccact
ggaagtgccaagaagtacgcactagtaattggcggtggtctactaggactggaggctgcg
aaggccgtccacgacctgaagctgtccgtacggatcatcgaccgcggtacgcggctcatg
tcacggcaactcgatgctgacggtgctaaggttcttcacaacgagatcgtcaataagttt
gggatcgacgttctctacgaaaagtcgactcaagagatcatcggcactgaagagagcggt
gtcgaggccgtggagttcaccaatggcgagcggtttgacaacgtgtgtatggtcatcttc
gctaccggaatcaagccacgggacgagctcgctcactccagtggcctcgaactggcaaag
cgcggcgggattctcatcaacgactacttggagtgcagcgaaccgtatgtgtacggcatt
ggcgagtgtatttcacaccgcgacgtcacgtacggtctcgtcgctccgggttacgagatg
gctgacacattggcgaagaacttaacttgtggatctccagagaaccgtatcgcattcccg
ggtggagacgtctcgacaaagctcaagctcatgggaatggaggtgggctcgttcggtgac
tacttcccggagtttatcagcgagccgttcgaggtgttaacgtacaataaccctcttgag
aatgtgtacaagaagctcttcttttctgtcgatgcgagcaagctcctgggtggaattctg
gttggtgacacgagtgactttgtgcgtctatcgctaatgttcaagcaaaaagataccaaa
cctttggtagatccaccaaacgaaatacttcttaagaagagaggtggtggcagtagtaca
gtcttggatctacccgatgaagctcaagtgtgttcgtgcaacaatgtgagcaaaggagac
atctgccaagctattaaagagaagaaattgaccaagcttggagacgtcaagaaggtctgc
aacgtcggcaccggctgtggcggctgtatgcctatggtgaaggacattctggaagccgaa
ctggctgctgccggtgcggaagttgacaagtcactatgcgaacacttcgcgtattcacga
caggagctgtaccagatcatacaagtcgaacaatacgccacgttcgccgaagttttagcc
aaacacggtcgcaaacagcacgctcctcgtagctacggatgcgagatctgcaagcccaca
atcgcctcgatcctcgctagtctccagaacgggcatatccttaaaggagaccgtgccgcc
cttcaagactcgaacgaccgattcctggccaacctgcagaaatcgggtcaattctctgtg
gtgcctcgtgtggctggtggcgagatcacgccggacaagcttattgtgctcggccaagtg
gctaagaggttcgatctgtacaccaagatcacagggggacaacgtgttgatctgtttggt
gcccagaagcaagacctgcccgagatctggaggatgctggtacatgctggctttgagtcc
ggtcatgcgtacggcaagtcattgcgaacagtgaagagctgtgtgggcacgacgtggtgt
cgctatggtcagcaggactctgttggcttcgccgtcttccttgagaaccgctaccgcggc
atccgttcgccacataaacttaaaggaggcgtctctggatgcacccgtgagtgtgctgaa
gctcgcagcaaagatttcggctgtatcgctacggatcaaggctacaacgtgtatgtgggc
ggcaatggcggcacgaacccacgccatgctacactcctggcttcagatgttccgcaagaa
ctggccgttaagtatctggatcgatacatcatgtattacatcatgacggccgatcgtctg
caacgtacatccaagtggctggatgcacttgaaggaggcatcgagcagcttcgtcgtgta
gtaatggaggactcgctgggtatatgtgccacactcgagaagcagatgagctatctggtt
ggaacctacgagtgcgagtggaagaaggtgatcgagtcacctgaactcctggctcagttc
gcccagttcaagaacactaacgagactcagaaggaagtgcagatgaagaccgtgcgggat
caacgcatgccgacattcgtggcgcacgctaagactggaagtagtgggactggcaccgag
tcttcgtctcctgcatcaactacttcagtgttatcagatctcgatgagacggagtgggtc
tcctttggcagcaaggatctattcgatatgaatagtggtggtgccgtgctgtatggtgag
tcgcagttggcgatcttcaacatcacagagagctgcaacggcatcgagaaggtgtcgtgg
tatgccacccagaacatgtgtccttatgaccactcgttcgtgttggctcaaggcatcgtg
ggcgacctggatggcagaccgaaagtggcgtgtcccatgcacaaatgcaacttcgatctc
agcgacggctgctgcctcagcggtaatgactttcgtcttcagacgttcgatgccaaggag
gaggaagggatcatttacgttttattaccacctgtggatgcgattgacgctaggcttgca
acgtccaagttcattgcgaaggacagagatgtttcagtactcccggtggtgtcaaaagca
cccgtcacgcttgactggtag

DBGET integrated database retrieval system