KEGG   Phytophthora infestans: PITG_13980
Entry
PITG_13980        CDS       T01333                                 

Definition
(RefSeq) ARP2/3 complex 20 kDa subunit
  KO
K05755  actin related protein 2/3 complex, subunit 4
Organism
pif  Phytophthora infestans
Pathway
pif04144  Endocytosis
Brite
KEGG Orthology (KO) [BR:pif00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    PITG_13980
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:pif04131]
    PITG_13980
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:pif04812]
    PITG_13980
Membrane trafficking [BR:pif04131]
 Others
  Actin-binding proteins
   Arp2/3 complex
    PITG_13980
Cytoskeleton proteins [BR:pif04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actin-binding proteins
    Arp2/3 complex
     PITG_13980
SSDB
Motif
Pfam: ARPC4
Other DBs
NCBI-GeneID: 9461831
NCBI-ProteinID: XP_002899637
UniProt: D0NN90
AA seq 170 aa
MWANTLAPYLNSIRSSLDSALCLRNFPSQAVERHNKPEVELQMSKELLLNPVLICRNEQE
KCLIEPSINSTRVSICIKKADEIETILSHKFNRFLMQRAEQFIIMRRVPVEGYDMSFLVV
HQHLENMYKHKLIDFIITFMEDIDKEISEMKISLNARGRIVATEFMKQFT
NT seq 513 nt   +upstreamnt  +downstreamnt
atgtgggccaacacactcgccccatacctcaactccatccgcagctcgctggactcggcg
ctgtgtctgcgcaacttcccgtcacaggccgtagagcgccacaacaagcccgaagtggag
ctacagatgagcaaggaactacttctgaaccccgttctcatctgccgtaacgagcaggaa
aagtgtctgatcgagccgtctatcaactcgacacgcgtgagcatctgcatcaagaaggcg
gatgagatcgagacgattctgagccacaagttcaaccgcttcctcatgcagcgagccgag
caattcatcatcatgcggcgagtgcccgtggagggctacgatatgagttttctcgtggtg
caccagcacctcgagaatatgtacaaacacaagctcattgacttcatcatcaccttcatg
gaggatatcgacaaggagatcagcgaaatgaagatttcgctcaatgcacgtggccgcatt
gtcgccactgagttcatgaagcagtttacctaa

DBGET integrated database retrieval system