KEGG   Phytophthora infestans: PITG_14229Help
Entry
PITG_14229        CDS       T01333                                 

Definition
(RefSeq) mannose-1-phosphate guanyltransferase beta, putative
  KO
K00966  mannose-1-phosphate guanylyltransferase [EC:2.7.7.13]
Organism
pif  Phytophthora infestans
Pathway
pif00051  Fructose and mannose metabolism
pif00520  Amino sugar and nucleotide sugar metabolism
pif01100  Metabolic pathways
pif01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:pif00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    PITG_14229
   00520 Amino sugar and nucleotide sugar metabolism
    PITG_14229
Enzymes [BR:pif01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.13  mannose-1-phosphate guanylyltransferase
     PITG_14229
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: NTP_transferase Hexapep NTP_transf_3 Fucokinase Hexapep_2 IspD
Motif
Other DBs
NCBI-GeneID: 9474272
NCBI-ProteinID: XP_002899327
UniProt: D0NNX5
AA seq 359 aa AA seqDB search
MKALILVGGFGTRLRPLTLSCPKPLVEFCNKSIVMHQIEALVAVGVTEVILAVNYQPQVM
LAALESMEKKYHIKISCSHETEPLGTAGPLALARELLDDGDPFFVFNSDVICEYRLEDFL
DFHKAHGAEGTIMVTRVDEPSKYGVVISDADGQIQRFVEKPREYVGNKINAGIYIFNREV
LDRIQLRPTSIEKEIFPQMAAEGNLFSMVLPGYWMDIGQPKDFLSGMCLHLDYVERTNAD
ALSTGPKFIGNVMVDPTAVIGDGCLIGPNVVVGPGCVIEDGVRLSRTTLLRGVTVRANSW
IQSSIIGWGSTIGRWCRIEGITVVGEDVQVKDEKFINGGLILPHKAISASIPDPGTIVM
NT seq 1080 nt NT seq  +upstreamnt  +downstreamnt
atgaaggcgctgatcctcgtcggaggcttcggcacgcggctgcggccgctcacgctgtca
tgccccaagcccctggtggaattttgcaacaagtccattgtgatgcaccagatcgaggcg
ctcgtggcggtgggggtaacagaggtgattctggctgtcaactaccagccgcaagtgatg
ctggcagcgctcgagtccatggagaagaagtaccatatcaagatctcatgttcccatgag
actgagccgctgggtaccgccggcccattggcgttggcccgtgagctgctggacgacggc
gacccgttcttcgtattcaacagcgacgtcatctgcgagtaccgactggaagatttcctg
gacttccacaaggcccacggagccgagggcaccatcatggtgactcgtgtggacgagccg
tccaagtacggtgtggtgatctccgatgctgacggacaaatccaacgcttcgtggagaag
ccgagggagtacgtgggcaacaagatcaacgctggcatctacatttttaaccgagaagtg
ctggaccgcatccagttgcgaccgacgtccatcgagaaggagatcttcccacagatggca
gccgagggaaatctcttctcgatggtgttgccaggatactggatggacatcggccagccc
aaggatttcctctcgggtatgtgtctgcacttggactacgtggagcgcacgaacgcagat
gctctgtccacaggcccaaagttcattggcaacgtgatggtggaccccacggcagtgatc
ggagacggatgtctgattggacccaacgttgtggtcggacctggatgtgtcattgaagac
ggtgttcgacttagtcgaacgacgctgcttcgtggtgtgacagtccgcgcaaactcgtgg
atccagtcaagcattatcggatggggctccactattggccgatggtgccgaattgaggga
atcactgttgtcggtgaagacgtgcaggtgaaggatgagaagtttatcaacggcggtctc
atcctgccacataaagccatctcagccagcattcccgaccctggtaccatcgtcatgtga

DBGET integrated database retrieval system