KEGG   Phytophthora infestans: PITG_14238Help
Entry
PITG_14238        CDS       T01333                                 

Definition
(RefSeq) glycoside hydrolase, putative
  KO
K01193  beta-fructofuranosidase [EC:3.2.1.26]
Organism
pif  Phytophthora infestans
Pathway
pif00052  Galactose metabolism
pif00500  Starch and sucrose metabolism
pif01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pif00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    PITG_14238
   00500 Starch and sucrose metabolism
    PITG_14238
Enzymes [BR:pif01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.26  beta-fructofuranosidase
     PITG_14238
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_32N Glyco_hydro_32C
Motif
Other DBs
NCBI-GeneID: 9474277
NCBI-ProteinID: XP_002899332
UniProt: D0NNY0
AA seq 666 aa AA seqDB search
MKVIPSIMAFSALVAALVFSPENAHAAIVEAEPGTELFEQFRPVYHFVAREKWMNDPCAP
YYDEDTGLYHMFYLSNPNSTIWGNMTWGHAVSKDQVTWKDYPHALLPFQDKWDNLGVFSG
FAMNNAIDGKHTIFYTGVTALPISWKKEYLFGEHVMYATTSNGGSTWHKGTKPLIELPPK
GMNVTGWRDPMPFHSQSLDKHFGFDATTGSNYLLVAGGIHNAGPRIFLYHSEDYLDWEYK
GFLLAQEKNVKFSRYSANWGYNFETTIYREMKDEDGELHNVMLFAAEGEPNRYPMWATGT
FGAAGSDSGSGSDEGLFTPLMVGISDRSDWYANSIYTDKHGKDVMIGWITEDNNFAEGQP
QGWDGVLSVPREVGIAIVRDIYDADDHLVGQGDWIVSDTKNVSLADGSTVESKTIKTLKV
RPLSDLKLLRNPETLEEVYSMALNGRSRALKSKGKSFEIKAQVANFERGTQVGFTVRHSK
TGDEATTIVYDDKKKMVIIDRTSSSNAECAVFEDNKVTPVDDPVWGHFYLYDVFESVSDL
DAASHSDAGSDEEVDENSDSADQADSDSEADSSEADKDTYKVTRENLNFHLFVDVSTVEV
FVNNRFALSARIYPCGEASNGISLTASGKTTFEKVQVWTDPKHAWPAKRTVPTKQVHKKT
GKVVDE
NT seq 2001 nt NT seq  +upstreamnt  +downstreamnt
atgaaggtgatcccgagcatcatggcatttagtgccctcgtcgctgccctggtcttcagc
cccgagaatgcccacgccgccatcgtggaagccgagcccggtactgagcttttcgaacag
ttccgtccggtttaccacttcgtggctcgtgaaaagtggatgaacgacccgtgcgcaccc
tactacgatgaagacactggtttgtatcacatgttctacctgtcgaacccgaactcgacg
atctggggcaacatgacgtggggtcacgccgtgtcaaaggaccaggtgacctggaaggac
tacccgcatgctcttctgccattccaggacaagtgggacaacctcggcgtgttttcgggt
ttcgcgatgaacaatgctattgacggcaagcacaccatcttctacacgggtgtcaccgcc
ctacccatttcgtggaagaaggagtacctctttggtgaacacgtgatgtacgccaccacc
agcaatggtggttcgacgtggcacaagggcactaagccgctcattgagctaccgcccaag
ggcatgaacgtgaccggctggcgtgatccgatgccattccactcgcagtctttggacaag
cacttcggcttcgacgccaccaccggaagcaactatctgttggtggccggtggcatccac
aacgcgggtccgcgtatcttcctctaccattccgaagactacttggactgggagtacaag
gggtttctgctcgcacaggaaaaaaacgtaaagttctctcgttacagcgccaactggggc
tacaactttgagacgaccatttaccgtgagatgaaggatgaggacggtgaattgcacaac
gttatgctgttcgctgctgaaggtgagccgaaccggtacccgatgtgggccactggtacg
tttggtgccgccggcagcgacagcggctcgggctctgatgaaggtctatttacccccctc
atggtcggcatatcggaccgcagcgactggtacgcgaacagcatttacacggacaagcac
ggcaaggacgtgatgattggttggatcactgaggacaacaacttcgccgaaggacagccc
cagggctgggacggtgtcctgtcggtccctcgtgaggttggtatcgccattgtgcgtgat
atctacgatgcagacgaccacctggtcggccagggcgactggatcgtgtccgacactaag
aacgtctcgctggctgacggctcgaccgtggagagcaagacgatcaagacgttaaaggtg
cgcccgctgagcgatttgaagctgctacgtaaccccgagactctggaggaagtctacagt
atggcgttgaatggcagatcgcgggcgctgaagtccaagggcaagtcgttcgagatcaag
gcccaggtggcgaactttgagcgcgggacgcaggtgggtttcactgtgcgtcacagcaaa
acgggcgatgaggcaaccacaattgtgtacgacgacaagaagaagatggtgatcatcgac
cgcaccagcagctccaacgccgagtgcgctgtctttgaggacaacaaggtgactcctgtc
gacgacccggtgtggggccacttctacctctacgacgttttcgagtctgtctctgatctg
gatgctgcttcgcactcggacgctggatctgatgaggaggttgatgagaattcagactcg
gctgatcaggcggactcggactcggaggcggacagctcggaggcggacaaggacacgtac
aaggttacgcgtgagaacctcaacttccacctgtttgtggatgtgtcgacggtggaggtg
ttcgtgaacaaccgcttcgctctttccgctcggatctacccgtgcggtgaggcctcgaat
gggatctcgctgacggcatcaggtaagaccactttcgagaaggtgcaggtatggaccgac
cccaagcatgcgtggccggctaagcgtacggtgcctaccaagcaggttcacaagaagact
gggaaggtcgttgacgagtaa

DBGET integrated database retrieval system