KEGG   Phytophthora infestans: PITG_15626Help
Entry
PITG_15626        CDS       T01333                                 

Definition
(RefSeq) superoxide dismutase 2
  KO
K04565  superoxide dismutase, Cu-Zn family [EC:1.15.1.1]
Organism
pif  Phytophthora infestans
Pathway
pif04146  Peroxisome
Brite
KEGG Orthology (KO) [BR:pif00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    PITG_15626
Enzymes [BR:pif01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     PITG_15626
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Sod_Cu
Motif
Other DBs
NCBI-GeneID: 9465665
NCBI-ProteinID: XP_002897761
UniProt: D0NT78
AA seq 155 aa AA seqDB search
MAKAVCTLYGDDATVYGSLVITQAHEDAKTVVTGELKGLSPGKHALHVNAFGDVSQSSGA
ALGGVFNPFGKNHGAPEDAERCAGSLGNVEVGEDGNVKVHVEDKLVKLIGPHSIIGRSIV
VHDGEDDLGKGGHELSLQNGNAGAIKAYGVVGISS
NT seq 468 nt NT seq  +upstreamnt  +downstreamnt
atggccaaggcggtgtgcactctctacggcgacgacgcgaccgtgtacggctcgcttgtg
atcactcaggcgcacgaggacgccaagaccgtcgtcacgggcgaactcaagggtctctcg
cccggcaagcacgcgctgcacgtgaacgctttcggtgacgtgtcgcagtcgtcgggcgct
gcgctgggcggcgtgttcaaccccttcggcaagaaccacggcgcccctgaggacgctgag
cgctgcgctggctcgctgggcaacgtggaagtgggcgaggatggcaacgtcaaggttcat
gtggaggacaaattggtgaagcttatcggcccccactcgatcatcggccgcagtattgtg
gtgcacgacggtgaagacgacctaggaaagggtggccacgaactttcgctgcagaacggc
aacgctggcgcaatcaaggcttatggcgtcgtgggcatctccagctag

DBGET integrated database retrieval system