KEGG   Phytophthora infestans: PITG_16311Help
Entry
PITG_16311        CDS       T01333                                 

Definition
(RefSeq) ubiquitin family protein, putative
  KO
K08770  ubiquitin C
Organism
pif  Phytophthora infestans
Brite
KEGG Orthology (KO) [BR:pif00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:pif04121]
    PITG_16311
Ubiquitin system [BR:pif04121]
 Ubiquitins and Ubiquitin-like proteins
  Ubiquitins
   PITG_16311
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ubiquitin Rad60-SLD Ubiquitin_2 TBK1_ULD Rad60-SLD_2 Ubiquitin_5 DUF2407
Motif
Other DBs
NCBI-GeneID: 9473760
NCBI-ProteinID: XP_002897374
UniProt: D0NTZ3
AA seq 305 aa AA seqDB search
MQIFVKTLTGKTITLDVEPSDSIDNVKQKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN
IQKESTLHLVLRLRGGMQIFVKTLTGKTITLDVEPSDSIDNVKQKIQDKEGIPPDQQRLI
FAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLDVEPSDSIDNVKQ
KIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKT
ITLDVEPSDSIDNVKQKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLR
LRGGN
NT seq 918 nt NT seq  +upstreamnt  +downstreamnt
atgcagattttcgtgaagactttgaccggcaagacgatcacgctggacgtggagccttcg
gactcgatcgacaacgtcaagcaaaaaattcaggacaaggaaggcatccctcctgaccag
cagcgtctgatcttcgctggtaagcagctggaggacggccgcacgctgagcgactacaac
atccagaaggagtctacgcttcacctggtgcttcgcctgcgtggtggcatgcagatcttt
gtgaagactttgaccggcaagacgatcacgctggacgtggagccttcggactcgatcgac
aacgtcaagcaaaaaattcaggataaggaaggcatccctcctgaccaacagcgtctgatc
ttcgctggcaagcagctggaggacggccgtacgctgagcgactacaacatccagaaggaa
tcaacgcttcatctggtgcttcgcctgcgtggtggcatgcagatttttgtgaagactttg
accggcaagacgatcacgctggacgtggagccttcagactcgatcgacaacgtcaagcaa
aaaattcaggacaaggaaggcatccctcctgaccaacagcgtctgatcttcgctggtaag
cagctggaggacggccgtacgctgagcgactacaacatccagaaggagtcaacgcttcat
ctggtgcttcgcctgcgtggtggcatgcagatctttgtgaagactttaactggcaagacg
atcacgctggacgtggagccttcagactcgatcgacaacgtcaagcaaaaaattcaggac
aaggaaggcatccctcctgaccagcagcgtctgatcttcgctggtaagcagctggaggac
ggccgcacgctgagcgactacaacatccagaaggagtcaacgcttcacctggtgcttcgc
ctgcgtggcggtaactaa

DBGET integrated database retrieval system