KEGG   Phytophthora infestans: PITG_16359Help
Entry
PITG_16359        CDS       T01333                                 

Definition
(RefSeq) UTP-glucose-1-phosphate uridylyltransferase
  KO
K00963  UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
pif  Phytophthora infestans
Pathway
pif00040  Pentose and glucuronate interconversions
pif00052  Galactose metabolism
pif00500  Starch and sucrose metabolism
pif00520  Amino sugar and nucleotide sugar metabolism
pif01100  Metabolic pathways
pif01130  Biosynthesis of antibiotics
Module
pif_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:pif00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    PITG_16359
   00052 Galactose metabolism
    PITG_16359
   00500 Starch and sucrose metabolism
    PITG_16359
   00520 Amino sugar and nucleotide sugar metabolism
    PITG_16359
Enzymes [BR:pif01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     PITG_16359
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: UDPGP
Motif
Other DBs
NCBI-GeneID: 9465002
NCBI-ProteinID: XP_002897421
UniProt: D0NU40
AA seq 481 aa AA seqDB search
MHYKTHMPARFSIDDQMAEALASQELMGNRQRKNFLKLFRKYSKVKKTSIDWNSVKPPTS
GMLTSNTSVESCPNDMNLRHELLDKLVILKLNGGLGTTLGCEGPKSAIEVRQDLSFLDLT
VRQVEYLNSVYGVDVPLVLMNSFNTHEETVRIIRKYRMHNLSIHTFNQSCYPFIIKETML
PLPNTKYDRSTREKWFPPGHGDVYNALFESGLLESLINQGKEYIFISNVDNLGATVNLDM
LYHMINEDSEFVMEVTEKTRADVQGGTLVSYKDKPHLLEASQVPPGHLDDFRAINKFETF
NTNNLWVNLRAIQRLVAQDLIDMEPLVTFRTVRNHKVVQLETAAGEAIHLFKNFIGLKVP
RSRFLPVKSSSDLFLVQSNLYQIKHGSLIMNPARTTPTIPIVKLGLKFQSAKEYLARFEL
GIPNITELDHLTVAGDVKFGSNITLKGTVILVANEGAHIDLPEGTVLENKVVTGNLRILD
H
NT seq 1446 nt NT seq  +upstreamnt  +downstreamnt
atgcactacaagacacacatgccggcgcgattctccatcgatgaccagatggccgaggcg
ctagcgtcacaggagctcatgggcaaccgccagcggaagaacttcctaaaactctttcgt
aaatactccaaggtcaaaaagacctccatcgactggaattcagtgaagccgccgacgagc
ggcatgctgacgagtaacacgtcggtggaaagctgtcctaacgacatgaatctgcgtcac
gagctgctggacaagctggtcattttgaagctcaatggcggcctcggtacgacgctgggc
tgcgaaggacccaagagcgcgatcgaagtgcgccaagacctgtcctttcttgaccttact
gtgcgtcaagtggagtatttgaacagcgtgtacggtgtagacgtgccgctcgtgctcatg
aactcgttcaacacccacgaggagactgtgcgcattattcgcaagtaccgtatgcacaat
ctgagtatccacacgttcaaccagagctgttacccgttcatcatcaaggagacaatgctg
ccactgccgaacactaagtacgatcgctcgacgcgtgagaaatggttccctcctggccat
ggtgacgtctacaatgcgctgtttgagtcgggcttactggagagtcttattaaccagggc
aaggagtacattttcatctcgaacgtggacaatttgggtgccacagtgaatctggacatg
ctctaccatatgatcaacgaagactcggagtttgttatggaagtgaccgagaagactcgt
gcggatgtccagggaggcacattggtgagctacaaggacaaaccgcatctcctagaagcc
agccaagtgcctccaggacatttggacgacttccgggccatcaacaagttcgagacgttc
aatacaaacaacctatgggtgaatctgcgcgcaatccagagactggtggcgcaagatctc
atcgacatggagccgctcgtcacgttccgcactgtaaggaaccacaaggttgtgcaactg
gagactgcagcaggcgaggctatccacctcttcaagaactttatcggacttaaggtgcca
cgctcgcgtttcctgcctgtcaagtcgtcgtccgatctcttcctcgtgcagtcgaacttg
taccagattaaacacggtagtctcatcatgaacccggcacgaacgacgcctacgatcccg
atcgtgaagctcggactaaagtttcagagcgcgaaagaatatttggcacgcttcgaactc
ggcatcccgaacatcacggagctagatcacctcacagttgccggcgacgtcaagtttggg
tccaacatcacactcaagggaactgtcatccttgtggcgaatgaaggtgctcatattgac
ttgcccgaaggaacggtgctagaaaacaaggtggtgacgggtaatttgcgcattttggat
cactaa

DBGET integrated database retrieval system