KEGG   Phytophthora infestans: PITG_16528Help
Entry
PITG_16528        CDS       T01333                                 

Definition
(RefSeq) hsp70-like protein
  KO
K03283  heat shock 70kDa protein 1/2/6/8
Organism
pif  Phytophthora infestans
Pathway
pif03040  Spliceosome
pif04141  Protein processing in endoplasmic reticulum
pif04144  Endocytosis
Brite
KEGG Orthology (KO) [BR:pif00001]
 09120 Genetic Information Processing
  09121 Transcription
   03040 Spliceosome
    PITG_16528
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    PITG_16528
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    PITG_16528
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:pif01009]
    PITG_16528
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:pif03041]
    PITG_16528
   03009 Ribosome biogenesis [BR:pif03009]
    PITG_16528
   03110 Chaperones and folding catalysts [BR:pif03110]
    PITG_16528
   04131 Membrane trafficking [BR:pif04131]
    PITG_16528
   03051 Proteasome [BR:pif03051]
    PITG_16528
   03029 Mitochondrial biogenesis [BR:pif03029]
    PITG_16528
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:pif04147]
    PITG_16528
Protein phosphatases and associated proteins [BR:pif01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-5
    PP5-interacting proteins
     PITG_16528
Spliceosome [BR:pif03041]
 Complex B
  Other components
   Prp19 complex
    PITG_16528
 Complex C
   Prp19-CDC5 complex
    PITG_16528
Ribosome biogenesis [BR:pif03009]
 Eukaryotic type
  Pre-60S particles
   Export and cytoplasmic maturation factors
    PITG_16528
Chaperones and folding catalysts [BR:pif03110]
 Heat shock proteins
  HSP70 / DNAK
   PITG_16528
Membrane trafficking [BR:pif04131]
 Endocytosis
  Clathrin-mediated endocytosis
   Other core components
    PITG_16528
 Autophagy
  Chaperone mediated autophagy (CMA)
   Chaperones
    PITG_16528
Proteasome [BR:pif03051]
 Eukaryotic proteasome
  Assembling factors
   Other assembling factors
    PITG_16528
Mitochondrial biogenesis [BR:pif03029]
 Mitochondrial protein import machinery
  Endoplasmic reticulum membrane and cytosol
   Other ER-memrane and cytosol factors
    PITG_16528
Exosome [BR:pif04147]
 Exosomal proteins
  Proteins found in most exosomes
   PITG_16528
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: HSP70 MreB_Mbl Raco_middle
Motif
Other DBs
NCBI-GeneID: 9465308
NCBI-ProteinID: XP_002897553
UniProt: D0NTV3
AA seq 561 aa AA seqDB search
MTTNTYDSWGSAAEHFADGSICLGIDLGTTNSCVGMWYVDRNHVKIFKNHLDRGRTTPSV
VRFDPKSQSVAVGNVAVGLETSEPVENTIRSVKRLMGQKFDSKAVDVARIYASYEVAPTA
QGNVAVQVVRGQKKVQVQPEEVSACVLRELKASADAYFDGHTKLDNVVITVPAYFSDTQR
KATIASASMAGFKAVRLLNEPTAAAMAYGLFLSGTKLVTVFDFGGGTLDVSLLSIEDGKF
EVLGIGGDTNLGGEDINNTLLDHVLDVLYRRHNVTRAQVGQADMVRLKREVEKAKIELSE
QEDAEISVHDIADVSTFTYTLTRRKFEQLCDAIWKKCLRIVSSVLRDAEVEPSDIDEVIL
VGGSTRIPVLRTKISEAFNGKELCMSVNADEVVCEGAAIQAAILSGMDQRVFRDVLMMDV
LPLPIGLETADGSMEVILLRNARIPTTVTKYFQTYEDEQRGLTVEVYEGEKEVAKENDHI
CYFNFALPRDKVGKAGEFAHPVTFTMNASGILQVQAGVHHDSEESPMSKAAVFLMGAYIL
ALSGFYVFFRIYFADERDITA
NT seq 1686 nt NT seq  +upstreamnt  +downstreamnt
atgacaaccaacacgtacgatagttggggcagcgccgccgagcacttcgcggacggctct
atctgcctcggcatcgacctaggcaccaccaactcatgcgtggggatgtggtacgtggat
cgaaaccacgtgaaaatctttaaaaatcatctggatcgcggtcgcacgacgccctctgtg
gtgcgctttgaccctaagagtcagagcgtagctgtgggcaatgtagctgtcggtctggag
acttcggagcctgtggagaacaccatccgctcggtcaaaaggctcatggggcagaaattc
gacagcaaagctgtagacgtcgccaggatctacgcctcctatgaggtggcacccaccgca
caaggaaacgttgcagtccaagtagtccgaggccagaaaaaggtgcaagtgcagcccgaa
gaggtctctgcctgtgtattaagagagcttaaagcctccgctgatgcctatttcgacggc
catactaagctggacaatgtggttatcacggtaccagcatactttagcgatacgcagagg
aaagcgactattgcaagtgcctcaatggcgggatttaaagctgtgagactgctaaacgag
cccacagcggccgctatggcgtacggattgttcctgtccggcacaaagctagtaacggtg
tttgatttcggcggagggacactggatgtgtcgctgctgagtattgaagacggcaagttt
gaagttctgggcattggaggcgacacgaacttaggcggggaagatatcaataatactcta
ctggatcatgtgctagacgtgctgtatagacgtcataacgtgacacgtgcccaagtgggt
caagcagatatggtgagactgaaacgagaagtcgagaaggcgaagatcgagctgtcggag
caagaagacgcggagatatccgtgcatgatattgctgacgtgtcgacgttcacgtatacg
ttgacacgacgcaagttcgagcaactatgtgacgctatctggaaaaaatgtcttcgtatt
gtgtcgagtgtgctgagggacgcagaagtggaaccttcggacattgacgaagtaattcta
gtggggggatccacccgcatcccggttctacggaccaagatctcagaggctttcaacggc
aaagaactctgcatgtctgtgaacgctgacgaagtggtgtgtgagggagctgctatccag
gctgcgatcttgagtggaatggaccagcgtgtgttccgtgatgttctcatgatggacgtc
cttccgttgccaattggactggagactgcggatggctccatggaagtgattctccttaga
aatgcacgcatcccgacgacagtgacgaagtatttccaaacgtacgaagatgagcagcgt
gggctgactgtcgaggtttatgaaggcgagaaggaggtcgctaaggagaacgaccacatc
tgctactttaacttcgcgctaccacgagacaaggtcggcaaggcgggcgagttcgctcat
cccgtcactttcacgatgaatgccagtgggattctgcaagtgcaggctggagttcaccac
gattcagaggaatcgcccatgtcgaaagctgccgtcttcctcatgggagcttacattctc
gcgctctccgggttttatgtgtttttccggatttactttgccgacgagagggacatcacg
gcatga

DBGET integrated database retrieval system