KEGG   Phytophthora infestans: PITG_17033Help
Entry
PITG_17033        CDS       T01333                                 

Definition
(RefSeq) Annexin (Annexin) Family
  KO
K17095  annexin A7/11
Organism
pif  Phytophthora infestans
Brite
Exosome [BR:pif04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   PITG_17033
  Exosomal proteins of other body fluids (saliva and urine)
   PITG_17033
  Exosomal proteins of colorectal cancer cells
   PITG_17033
  Exosomal proteins of bladder cancer cells
   PITG_17033
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Annexin
Motif
Other DBs
NCBI-GeneID: 9469200
NCBI-ProteinID: XP_002897237
UniProt: D0NUM8
AA seq 328 aa AA seqDB search
MLNLYPPATHSAWNGQPPAYPAGTDSTVNEIYEATKGAGTKEKQLNKALGGKTATERGFI
AKRYKELHNQSLRDLVDEETSGHYEFLLKLLASPLPEAEAGILRKATKGLGTKEDLIHPV
VVGRTNAEINILKKTYYETYGEDLGSVLDSDLHGDFKKVILASLQAALVPYDANIHNTAK
VEADVEKLYKTGRGKMGTDEEGFVGVLVASPPEHLRAVAAAYEKKYEESLVKAAAHEFRG
DSEKAVLFLIRMITEPLDLLAELFEEAMKGFGTDENALSSAVVRYHIVLRDIKPVYKKKF
GKELRERIAEEVSGDYGELLLSVFDARD
NT seq 987 nt NT seq  +upstreamnt  +downstreamnt
atgctgaacctgtacccgcccgccacgcacagcgcctggaacggccagccgcctgcgtac
ccggccggcacggactcgaccgtgaacgagatctacgaggctaccaaaggcgccggcacc
aaggagaaacagttgaacaaggcgctgggcggcaagacggccacagagcgcggtttcatc
gccaagcgctacaaggagctgcacaaccagagcctgcgcgacctggtggacgaggagacg
tcgggccactacgagttcctgctcaagctgctggcatcgcccctcccggaggctgaggct
ggcatcctgcgcaaggccaccaagggtctgggcacaaaggaggacctgatccaccccgtg
gtcgtaggccgtacgaacgcggagattaacatcctcaagaagacatactacgagacgtac
ggcgaggacctgggctctgtgctggacagcgacctgcacggcgacttcaagaaggttatc
ctggcgtcgctgcaggccgcgctggtgccgtacgacgccaacattcacaacaccgccaag
gtggaagctgacgtggaaaagctgtacaagactggtcgtggcaagatgggcacggacgag
gagggcttcgtcggtgtcctagtggccagtccgcccgagcacctgcgcgctgtggccgct
gcgtacgagaagaagtacgaggagtcgctcgtgaaggctgcggcccacgagttcagaggc
gactctgagaaggccgtgctgttcctcatccgtatgatcacggagccgctggatctgctg
gctgagctgttcgaggaggccatgaagggcttcggcacggacgagaacgctttgagctcg
gccgtggtgcgctaccacattgtgcttcgtgacatcaagccggtgtacaagaagaagttc
ggcaaggagctgcgtgagcgcatcgccgaagaggtaagcggcgactacggtgagctgctg
ctatcggtgttcgacgctcgcgactaa

DBGET integrated database retrieval system