KEGG   Phytophthora infestans: PITG_17298Help
Entry
PITG_17298        CDS       T01333                                 

Definition
(RefSeq) tRNA (cytosine-5-)-methyltransferase, putative
  KO
K15335  tRNA (cytosine34-C5)-methyltransferase [EC:2.1.1.203]
Organism
pif  Phytophthora infestans
Brite
KEGG Orthology (KO) [BR:pif00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:pif03016]
    PITG_17298
Enzymes [BR:pif01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.203  tRNA (cytosine34-C5)-methyltransferase
     PITG_17298
Transfer RNA biogenesis [BR:pif03016]
 Eukaryotic type
  tRNA modification factors
   Methyltransferases
    PITG_17298
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Methyltr_RsmB-F zf-CCHC_2 FtsJ
Motif
Other DBs
NCBI-GeneID: 9466536
NCBI-ProteinID: XP_002896806
UniProt: D0NVR0
AA seq 691 aa AA seqDB search
MATIISKAKPSLDVYKQSFREYLHETDAVKDETELEQLMKLLHEPLPVSFRLNLHRPDAS
RLKEMLATKFQFPSDKYFHGEVPVNPPKPIAWYPLEKVAWQMDCGRVALSKSAPKHEDVR
AFHSCLLEQTDRGNIDRQEAVSMLPVLFLDVQRSHRVLDMCASPGSKTTQVIDFLLSTEN
GDNGEQSGLVIANDLDKKRAYMLVHRLSRNTLRRAVVTCGAGDTFPGLYDAKTKTLQPTN
VFDRVLCDVPCSGDGTLRKNQTLWKEWHIGQGLTLHPTQLALALRGAALLRVNGIMVYST
CSFNPVENEAVVAELLRRAGGSLELLDVSNKMPGLIARPGRSKWRVGWRSKSKSTHKGHL
FKEDKHEDDQSLHQWFDSYEALTQELRGSRVTRSMFPTEGVIADELHKTLRLIPTDQNSG
GFFIAVLRKVGDLPGENGLQEGLSPLDELEATPPADYICKLCNKGGHFLKNCEKYLPGTE
FSDSNNSSKPQTKKRRTEETTKSEGKKKEKTRETLYRPVNDEVWQQLRGFYGLEDETLKD
RFWCRSDTAATVNYVDKEISDACLGGDALDIVNTGLKVFTKVTERGDVFYRPSEESLGFF
DEFFTKRRLDIPMTDFSNLIKNAEQHVAFDTLSSGLQKTLEGLAIGPAVVRVQTHAQVRM
NIWVGKGSILPRVSKAMRGEVEDALHRCSDN
NT seq 2076 nt NT seq  +upstreamnt  +downstreamnt
atggcgacgattattagcaaggcgaagccgtccctggatgtgtacaagcagagttttcgc
gagtatctgcacgagaccgacgccgtgaaggatgagacggagttagagcagctcatgaag
ctgctacacgaacctcttccagtgtccttccgactcaacctgcaccgtcctgacgcttca
agactgaaggagatgctggccaccaagttccaattcccgagcgacaagtatttccacgga
gaagtccccgtgaacccgcccaaaccaatcgcgtggtatccgctagaaaaggtggcgtgg
caaatggactgtggacgtgtggcgctctcgaaaagtgctccgaaacacgaggatgtgcgt
gcgttccattcgtgtttattggagcagacggaccgtggcaatatcgaccgtcaggaggct
gtgagcatgttaccagtattgtttctggacgtgcagcgtagccaccgcgtgctcgatatg
tgtgcttcacccggttcaaagacgacgcaagtaatcgactttttgctctcgactgagaac
ggggacaatggcgaacagagtggcctagtgattgccaacgacctggacaaaaagcgagcg
tatatgctggtgcatcgtctgtctcgcaacacgctacgtcgcgcagtggtaacgtgtggc
gctggcgatacattcccaggtctgtacgatgccaagacgaagactctacagcccaccaac
gtgttcgaccgcgtgttgtgtgacgttccttgcagtggcgacggtactctccgcaagaac
cagacgttgtggaaggaatggcacattggtcaaggtcttacgttgcacccgactcaactg
gcgttggcacttcgaggtgctgcgttgcttagagtaaacgggattatggtctactcgaca
tgttcgttcaatcctgtcgagaacgaggctgttgtggcggaacttctgcgtcgtgctggt
ggatcattggagctactggatgtgtcgaacaagatgccggggctgattgcacgtcctggt
cgatcaaagtggcgtgtgggttggcgctccaagtccaagtcgacccacaagggtcatttg
tttaaggaggacaagcacgaagacgaccagagtctgcaccaatggtttgacagctatgag
gcgctgacacaggagctccgtggtagtcgtgttactcgatccatgttccctactgagggt
gtcattgctgacgagcttcacaagacacttcgattgatcccaacggaccagaactcgggt
gggtttttcatcgctgtattgcgtaaagtgggtgatttaccgggtgaaaacggtcttcag
gaaggactttctccactggatgaactggaagccacccccccggctgactacatttgcaag
ctctgtaataagggaggccactttctaaagaactgcgagaaatatctgccgggtaccgag
ttttcagattcgaataattcgtccaagccacagacgaagaaacgtcgtacagaggagacg
acgaagagcgaagggaagaagaaggagaagacgcgcgagacgctctaccgtcctgtgaac
gacgaggtgtggcaacaactgcgtggattttacggtctcgaggatgagacgcttaaggac
cgcttctggtgtcgctctgacactgcagccactgtgaactacgtggacaaggagatttcg
gacgcttgcttaggtggtgacgctcttgatatcgtcaacacgggccttaaggtcttcacc
aaggtgacggagcgtggcgacgttttctatcgtccgtcagaggagagtctcggcttcttt
gacgaattttttaccaagcgacgactagacattcccatgactgacttctccaacctcatc
aagaacgcggagcagcatgttgcattcgacacgctgtcgtcgggtctgcagaagacactg
gaaggtttggccattggtcctgcggttgtccgagtccagacacacgcacaagtccgcatg
aacatttgggtgggcaaaggttccatcctgccgcgtgtgtccaaggccatgcgtggagag
gtcgaagatgcgctccaccggtgctcggacaactag

DBGET integrated database retrieval system