KEGG   Phytophthora infestans: PITG_17406Help
Entry
PITG_17406        CDS       T01333                                 

Definition
(RefSeq) enoyl-CoA hydratase, mitochondrial precursor
  KO
K07511  enoyl-CoA hydratase [EC:4.2.1.17]
Organism
pif  Phytophthora infestans
Pathway
pif00062  Fatty acid elongation
pif00071  Fatty acid degradation
pif00280  Valine, leucine and isoleucine degradation
pif00310  Lysine degradation
pif00380  Tryptophan metabolism
pif00410  beta-Alanine metabolism
pif00640  Propanoate metabolism
pif00650  Butanoate metabolism
pif01100  Metabolic pathways
pif01110  Biosynthesis of secondary metabolites
pif01130  Biosynthesis of antibiotics
pif01200  Carbon metabolism
pif01212  Fatty acid metabolism
Module
pif_M00013  Malonate semialdehyde pathway, propanoyl-CoA => acetyl-CoA
pif_M00085  Fatty acid biosynthesis, elongation, mitochondria
pif_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:pif00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    PITG_17406
   00650 Butanoate metabolism
    PITG_17406
  Lipid metabolism
   00062 Fatty acid elongation
    PITG_17406
   00071 Fatty acid degradation
    PITG_17406
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    PITG_17406
   00310 Lysine degradation
    PITG_17406
   00380 Tryptophan metabolism
    PITG_17406
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    PITG_17406
Enzymes [BR:pif01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     PITG_17406
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ECH_1 ECH_2 Peptidase_S49 DUF5034
Motif
Other DBs
NCBI-GeneID: 9471439
NCBI-ProteinID: XP_002896725
UniProt: D0NW02
AA seq 260 aa AA seqDB search
MATAEYENILTEVRGKVAIITLNRPKALNALCSPLIEELNGAAHAFDADKNIGAIVITGS
DKAFAAGADIKEMATKSFVDAYKSNMFANWGDITKVSKPVIAAVNGYALGGGCELAMLCD
LIIAGDSAKFGQPEITLGTIPGCGGTQRLIRAVGKSKAMEMILTGNMIDAQQAERDGLVA
RVVPADQLLDEALKTANKIASFSQPVVKMAKEAVNASYEQTLQEGIKFESRLFWSSFATK
DQKEGMAAFVGKRKAEFKDE
NT seq 783 nt NT seq  +upstreamnt  +downstreamnt
atggccacagccgagtacgagaacatcctgaccgaagtgcgaggcaaagtggcgatcatc
actctgaaccgccccaaggctctgaacgcactatgcagtccgctgatcgaggagctgaac
ggagcggcccacgccttcgacgccgacaagaacatcggcgccatcgtcatcacaggcagc
gacaaggcgttcgcggccggcgcggacatcaaggagatggccaccaagagcttcgtggac
gcttataagagcaacatgttcgccaactggggggacatcaccaaagtctccaagcctgtg
atcgctgctgtgaacggctacgctctgggcggcggctgtgagttggccatgctctgcgac
ctcatcatcgccggcgactcggctaagttcggccagccagagatcacgctcggcaccatc
cctggctgtggcggcactcagcgtctcatccgagctgtgggcaagtccaaggccatggag
atgatcctgacaggcaacatgatcgacgctcagcaggccgagagggacggacttgtggct
cgtgttgtgccggctgaccagctgctggacgaggctctcaagacggccaacaagatcgca
tcgttctcgcagcctgtggtcaagatggccaaggaggccgtcaatgcgtcctacgagcag
acgctgcaggagggaatcaaatttgagagccgcctcttctggagctccttcgccaccaag
gaccagaaggaaggcatggccgcctttgtggggaagcgtaaggctgagtttaaggacgag
taa

DBGET integrated database retrieval system