KEGG   Phytophthora infestans: PITG_17781Help
Entry
PITG_17781        CDS       T01333                                 

Definition
(RefSeq) hypothetical protein
  KO
K17890  autophagy-related protein 16-1
Organism
pif  Phytophthora infestans
Pathway
pif04136  Autophagy - other
Brite
KEGG Orthology (KO) [BR:pif00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04136 Autophagy - other
    PITG_17781
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:pif04131]
    PITG_17781
   03029 Mitochondrial biogenesis [BR:pif03029]
    PITG_17781
Membrane trafficking [BR:pif04131]
 Autophagy
  Autophagosome formation proteins
   Atg12 conjugation proteins
    PITG_17781
 Others
  Rab GTPases of specific organelles
   Auto phagosome
    PITG_17781
Mitochondrial biogenesis [BR:pif03029]
 Mitochondrial quality control factors
  Mitophagy factors
   Autophagy-related proteins
    PITG_17781
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: WD40 ATG16 ANAPC4_WD40 Nup160 FAD-SLDH
Motif
Other DBs
NCBI-GeneID: 9471367
NCBI-ProteinID: XP_002896628
UniProt: D0NW93
AA seq 494 aa AA seqDB search
MATSSSWFSSDALRLLEARNRREVTAFSELIASHQQLLFRSSLGASSSSLSASQRLTNPQ
EQDDATAQRYLAAIQKLEHELADRNAQLANYAGQQLALVSESKTLLQEREQWEQQLLLLT
KRLDEETVLSHEKDKALKELEDALVLSREELARQRALLEGSEAEGSRLRKRNAELERQVQ
EKNALLHEWIQSNSGEKSGEPSPALVAMATQEAAESLTHLLLNEEEGLSGEGVAKLVTHV
THSIRAHATEVNSVCFNTSGKILFSGSSDGTVRAWEAEAASLSPPRALGEYRGVGTAHPL
LCVRASEDGALILGTGCDRKCFVWRVGTGRVMQTLTGHKGKVLAAEFSPVTPHEVITGSS
DRSLRVWDVLRGVRLQTVSCVSSCNDIAAPSGADSGFVQFASAHQDGAVRFWDTRTRRCV
QELRGLHTEQTTSVSFGGSELLTNSRDHTLKVIDPRTYGVLRELHHKDFQCGFDWGQASL
SPDGRYALAGGAGS
NT seq 1485 nt NT seq  +upstreamnt  +downstreamnt
atggctacatcgtcttcttggttctcttcggatgctctacgtcttctagaggcccgcaac
cgacgtgaagtgaccgcctttagtgaattgattgcgtctcaccagcagcttttattccgc
tcgtcgctaggcgcgagctcctcgtctctaagtgcgtctcagcgtctcacaaaccctcag
gaacaagatgatgccactgcacagagatatttggcggctattcagaagctggaacacgaa
ctggcggacagaaacgcgcagctagcgaactacgcaggtcagcagctagcactggtgagc
gagagcaagacgctactccaagagcgcgagcaatgggagcaacagcttcttctgcttacc
aaacgtctggacgaggagacggtattaagtcacgagaaagataaggcgttaaaggagctt
gaagatgctttagtattatccagagaggagctagcgagacagagagcgctactggaaggc
agtgaagcggaggggagccgactcaggaagagaaacgctgaattagagaggcaagtgcag
gagaagaacgcgctgttgcatgaatggattcaatcgaacagtggagagaagagtggcgag
ccatctcctgctcttgtggcaatggctacacaggaggcagcagaaagtttgactcattta
ttattaaatgaggaggaaggactcagtggagaaggtgtagccaaactcgtgactcatgta
acgcactcgatccgcgcacacgccactgaagtaaattcggtgtgttttaacacgtcgggc
aagattttgtttagtggcagtagtgacggcacagtgagggcgtgggaagccgaggccgcg
tccttgtcgcctcccagagctctcggagagtacagaggagtgggtacagctcatccgttg
ctgtgtgtgcgagcatcagaggacggagcgcttatcttgggtacaggatgtgaccgcaag
tgctttgtatggagagtaggcactgggcgcgtcatgcagactcttacaggacacaaaggc
aaagtgttggcagctgaattctcgcctgttacgccacatgaagtgatcacaggctcgtca
gaccgcagtctccgtgtgtgggatgtcttgcgcggtgtgcgtcttcaaactgtgagttgt
gtatcgagctgcaatgacatcgcggcaccttctggagcagactcgggcttcgtacagttc
gcgagtgcgcatcaagacggtgcagtgcgcttctgggataccagaactagacgctgtgta
caggaactacgtggccttcacaccgagcagacgacttctgtgagttttggaggtagtgag
ttacttacaaactcacgggatcatactcttaaagttatcgatcctcgaacgtatggagtt
cttcgcgaattgcaccataaagactttcaatgtggctttgactggggccaagcgtctctc
agtcccgacgggagatacgctcttgcaggcggggcaggcagctga

DBGET integrated database retrieval system