KEGG   Phytophthora infestans: PITG_18706Help
Entry
PITG_18706        CDS       T01333                                 

Definition
(RefSeq) acetyl-CoA carboxylase, putative
  KO
K11262  acetyl-CoA carboxylase / biotin carboxylase 1 [EC:6.4.1.2 6.3.4.14 2.1.3.15]
Organism
pif  Phytophthora infestans
Pathway
pif00061  Fatty acid biosynthesis
pif00620  Pyruvate metabolism
pif00640  Propanoate metabolism
pif01100  Metabolic pathways
pif01110  Biosynthesis of secondary metabolites
pif01130  Biosynthesis of antibiotics
pif01212  Fatty acid metabolism
Module
pif_M00082  Fatty acid biosynthesis, initiation
Brite
KEGG Orthology (KO) [BR:pif00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    PITG_18706
   00640 Propanoate metabolism
    PITG_18706
  Lipid metabolism
   00061 Fatty acid biosynthesis
    PITG_18706
  Biosynthesis of other secondary metabolites
   00254 Aflatoxin biosynthesis
    PITG_18706
Enzymes [BR:pif01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.3  Carboxy- and carbamoyltransferases
    2.1.3.15  acetyl-CoA carboxytransferase
     PITG_18706
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.4  Other carbon-nitrogen ligases
    6.3.4.14  biotin carboxylase
     PITG_18706
  6.4  Forming carbon-carbon bonds
   6.4.1  Ligases that form carbon-carbon bonds (only sub-subclass identified to date)
    6.4.1.2  acetyl-CoA carboxylase
     PITG_18706
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ACC_central Carboxyl_trans CPSase_L_D2 Biotin_carb_N Biotin_carb_C Biotin_lipoyl ATP-grasp ATP-grasp_3 ATPgrasp_Ter Dala_Dala_lig_C GxGYxYP_N
Motif
Other DBs
NCBI-GeneID: 9477165
NCBI-ProteinID: XP_002997355
UniProt: D0NZ18
AA seq 2326 aa AA seqDB search
MTGHSTTGAAGETTPDTQNMVAEEAPPAADVAAYAETRSDSNPLNYASMEEYVRLQKGTR
PITSVLIANNGISAVKAIRSIRSWSYEMFADEHVVTFVVMATPEDLKANAEYIRMAEHVV
EVPGGSNNHNYANVSLIIEIAERFNVDAVWAGWGHASENPLLPDTLAQTERKIVFIGPPG
KPMRALGDKIGSTIIAQSAKVPTIAWNGDGMEVDYKEHDGIPDEIYNAAMLRDGQHCLDE
CKRIGFPVMIKASEGGGGKGIRMVHEESQVLSAWEAVRGEIPGSPIFVMKLAPKSRHLEV
QLLADTYGNAIALSGRDCSVQRRHQKIVEEGPVLAPTQEVWEKMMRAATRLAQEVEYVNA
GTVEYLFSELPEDNGNSFFFLELNPRLQVEHPVTEMITHVNLPAAQLQVAMGIPLHCIPD
VRRLYNKDAFETTVIDFDAEKQKPPHGHVIAARITAEDPNAGFQPTSGAIQELNFRSTPD
VWGYFSVDSSGQVHEFADSQIGHLFSWSPTREKARKNMVLALKELSIRGDIHTTVEYIVN
MMESDDFKYNRISTSWLDERISHHNEVRLQGRPDPLMVVLVGAVCCAYQASNALQEEYVS
QIERGQLPHNDMLSQEESLELIYEGIKYNIEACRSGPIQFTLFCNDSYVQVEIRTLSDGG
FLVLLNGKSHVAYATKEAQGLRLVVDSHTCVFTKEYDPTRLVTNTAGKLARYLVDDGASL
RRGMPYAEIEVMKMYMPLLTPEAGVIRLLKSEGAVLAPGDCIATMELDDPSCVKKSDVFM
GKLPSAENTNGSSTKSVHKMRKSLAVLKCVLQGYYAPEDLTQKALVDLFQVLNEPLLPVE
EIREAMSSLAGRIPLDVFAKITDKIQTFKKAVAEDPTAAHEFNAAEIADILDEHKKTLDT
DRKRSDFEASVVALRDITTKYKHGLASGEEAVLTELINEYFTVETVYANSHNIEDVVMAL
RQQNSADLNKVFSIARSHKALEAKNKLLLQLLAQMARGTAVTPRKSMKSASFVPLLEKLA
TFKEKQYSLVALEARQLLIDNKMPSYRDRLSQVEKVLKDYIANGSSTNLAEACANLLDQS
QPLFDLLISLLDHEDQKIRELALELYALRVYRSYLIESMETMSFNDIFAKTFQFKSPVVD
ALAVGVAPAESYDDLASLLRRNSSASSLDLGEQNSEESSEEQEPAEKPLAKPVESYQKIS
PSFERHGAIARLANLETFQKSFTDVMSLFPLAKKTLSVRKDPLVNVLHVILVDEHSEESK
LLEQAEAYLKSVDVDLRAHNIRRVTFSVRPQNIEDISVHNADMALYPNIYTFPGRMNYSE
DKILRHMEAPLAYKLELRRLQNYSVTPLASENKNVHLYLAKMKDSDAHIITDRFQRIFVR
AVVRQLDHDGSGSRSQYDAYPGPERSLVDALNALEVNLSNPLVKKSSLPTKNNHVYLNIL
PQAIVDPQYLEGVIRILAYRYAERLEQLGVSTVELKIIARFNSEAPAIPVRLVAENPTGY
VVRVQAYVEAAGHDEPIFTSIGDETHGELDGMPVTTPYPVVFPFDKKRQMAKAMSNTVYV
YDFLELIEYNLLRQWRKYVQQRTRGGGSKITIPNLLMETRELILDATGKALTETTRLRGQ
NDIGMVAWLLTLYTPEFQDGREIIIIANDITFKAGSFGTREDTLFDLASKLARSKGIPRF
FFSANAGARIGMAESIKALYKVCWKDETNPIKGFEYLYLTPEDYKVASAEGSVNAKLLVT
STGEERYVLNDIVGREIDLGVECLRGSGTIAGETSRAYQDVFTLTYACGRSVGIGAYLVR
LGQRTVQNATHSPIILTGYQALNKLMGKDVYTSNDQLGGVKIMHTNGVTHLTAKNHLSGI
YSILEWLSFVPAVRRGPLPIRDLTGVDEIERTVDFCPADKSTQYDPRALLAGKVDEATGK
WVSGLMDKDSFRETLDGWAKSVIVGRGRLGGIPCGVVVTEVRTSEKVIPADPASPASQEN
LMQQAGQVWFPDSAHKTATAIKDFKGEDLPLFILANWRGFSGGQRDMFDEVLKFGAAIVD
GLVNYEQPVFVYIPPFAELRGGAWAVVDPTINEGIMEMYADPQGRGGVLEPAGLIEIKYR
KKQLLQTMHRLDDKLKQLTARLGELSPEEKATEGAKISAEIKTREETLLPIYVQVATEFG
DLHDTPGRMKSVGCIRQVVPWSNSRRFFYWRLKRQLAEFTLRRQVVAASAGGPRATTFVG
SEQVLKGWFTEAVNGGRVPRQQNVSVSELWSHGDSDVLLWLSSDKEWIASRVAELRQEQM
ASQVVEIGRKDPKAAVAGILEVLNLLSDKDREEALNALRRGSIFHK
NT seq 6981 nt NT seq  +upstreamnt  +downstreamnt
atgactggccattccacaactggagctgcaggggagacgacacccgacacgcaaaatatg
gtggccgaggaagcgccccccgccgctgatgttgcggcttacgcggagacgcgcagcgac
agcaacccgctgaactacgcgagcatggaggagtatgtgcgtctgcagaagggtacgcgc
cccattacgtccgttctgatcgccaacaacggtatctcggccgtcaaggccatccgcagc
atccgcagctggagctacgagatgtttgctgacgaacacgtcgtgaccttcgtcgtcatg
gctacgcccgaggatcttaaggctaatgcagagtacattcgcatggccgaacacgtcgtc
gaagtgcccggcggctccaacaaccacaactacgccaacgtatctctcatcattgagatc
gccgagcgcttcaacgtcgacgccgtctgggccggctggggccacgcctctgagaatccg
cttctgcccgacacgctcgctcagactgagcgtaagatcgtctttatcggccccccgggc
aagcccatgcgtgcattgggcgacaagatcggctccactatcatcgcgcagagcgctaag
gtgcctacaatcgcctggaacggcgacggcatggaagtcgactacaaggaacacgacgga
atccccgacgagatctacaacgccgctatgttgcgtgacggccagcactgtctggacgaa
tgcaaacgtatcggcttccccgtcatgattaaagccagcgaaggcggaggtggcaagggt
atccgtatggttcacgaagagtcccaggtgctcagtgcctgggaagctgtgcgtggtgag
atccctgggtctcctatcttcgtcatgaagctggcacccaagtcgcgtcacttggaagtg
cagctattggcggatacgtacggcaatgccatcgctctcagtggccgtgattgctccgtg
cagcgtcgtcaccaaaagatcgtcgaggaaggtcccgtcctggcgcccacccaagaagtg
tgggagaagatgatgcgcgccgccactcgcctcgctcaggaggtcgagtacgtcaacgcc
ggtaccgtcgagtacctgttcagtgagctgccggaagacaacggcaactcgttcttcttc
ctggaactcaacccgcgtttgcaggtggaacaccccgtcacagagatgatcactcatgtg
aatctcccagctgctcaactgcaagtggctatgggtattccgctgcactgcatcccggat
gtgcgtcgtctgtacaacaaggatgcgtttgagacgacagttattgacttcgacgcggag
aagcagaagccaccgcatggacacgttatcgccgcgcgtattaccgccgaggatccgaac
gccggtttccagcctaccagtggagccatccaggagcttaacttccgtagtacgcccgat
gtatggggttacttctcggtggactcgtccggacaggtgcacgagttcgctgactcacag
attggtcacctgttctcgtggagtccgacccgtgaaaaggcccgtaagaacatggttcta
gcgctcaaggagttgtcgattcgtggtgatattcacacgacggtcgagtacatcgttaac
atgatggagtctgatgatttcaagtacaaccgcatctccacgtcgtggctggatgagcgt
atctcgcaccacaatgaagtgcgtctacagggtcggccggacccattgatggtggtgctg
gttggcgctgtgtgctgcgcgtaccaggcgtcgaacgcgctccaggaagagtatgtgagt
cagatcgaacgcggccaactgccccacaatgatatgctgtctcaagaagagtcgctggag
cttatttacgaagggatcaagtacaacatcgaggcgtgtcggagcggtcctattcagttc
acactgttctgcaacgactcgtacgtgcaggtggagatccgtacgctgtccgatggagga
ttccttgtgttgctgaatggcaagtcgcacgtcgcgtacgctactaaggaggcacagggt
ctgcgtcttgtggttgatagccacacgtgcgtgttcaccaaggagtacgaccccacgcgt
cttgtgaccaacacggccggtaagctcgcgcgttacctggtggacgatggtgccagtctg
cgtcgcggcatgccgtatgctgagatcgaagtcatgaagatgtacatgccgctactgact
ccggaagccggtgttatccgtctactcaagtcggagggcgcggtcttggcccctggcgac
tgcatcgcgacaatggagctggatgacccgtcctgtgtcaagaaatcggacgtgttcatg
ggcaagctgccgtccgcggagaacacgaacggtagcagtactaagtcggtgcacaagatg
cgcaagtcgctcgctgtgctgaaatgcgtgctgcagggctactacgcgcccgaggatctt
acacagaaggccttggtcgacttgttccaggtgctcaacgagcctctgctgcctgttgag
gagatcagggaagccatgtcgtcgctagctggtcgtatcccgcttgacgtgttcgcgaag
atcacggacaagatccagacgtttaagaaggctgtggctgaggaccctacggctgcccac
gagtttaacgccgctgagattgctgacattctggacgagcacaagaagacgttagacacg
gaccgtaagcgctcggactttgaggcgtctgtggtggctctccgcgacatcacgaccaag
tacaagcacggcttggcttctggtgaggaggcggttctgactgagctgatcaacgaatac
ttcaccgtagagacggtgtacgctaactcacacaacattgaggatgtggtgatggctctg
cgtcagcagaactcggcagacttgaacaaggtattctctatcgcgcgctcgcacaaggct
ctagaggccaagaacaagctgttgctgcagcttctggctcagatggctcgcggcacggct
gtgactccgcgcaagtcgatgaagtctgcttcgtttgtgccgttgctcgagaaactcgcg
acgttcaaggagaagcagtactcgctggtggctctggaggcgcgtcagcttctgattgat
aacaagatgccgtcgtaccgcgaccgtctcagtcaagtggagaaggtcctcaaggactac
atcgccaacggctcatccacgaacctcgctgaagcctgtgcgaacctgctggaccagtcg
cagccgctctttgacctgctcatttcgcttctcgaccatgaagaccagaagatccgcgag
ttggcgctagagctgtatgcgctgcgtgtttaccgctcgtaccttatcgagtcgatggag
accatgagcttcaacgacatcttcgccaagacgttccagttcaagtcgccagttgtcgac
gcgctggctgtcggtgttgcccctgctgagagctacgatgatttggcgagtcttctgcgt
cgcaacagctctgccagctcgctggacttgggagaacaaaactcagaggagagcagcgag
gaacaggagccggcggagaagccgctggccaagccggtcgagagctaccagaagatctca
cccagtttcgaacgtcacggcgctattgctcgtcttgcgaatcttgagactttccagaag
tcgtttaccgatgtcatgtcgctcttcccgctggctaaaaagacgctttcggtgcgcaag
gacccccttgtgaacgttctgcacgtcatcttggtggacgagcactcagaggagtcgaag
ctcctggaacaggctgaggcgtaccttaagtcggtggacgtggacctgcgcgcgcacaac
atccgtcgtgtgacgttctcggtgcgtccacagaacatcgaggacatctcagtgcacaac
gcggacatggcgctgtacccgaacatatacacgttccctggtcgtatgaactacagcgag
gacaagatcttgcgtcacatggaggccccgctggcgtacaagctggaactgcgtcgtctg
cagaactacagcgtcacgcctttggcgtcggagaacaagaacgttcacctgtatctggcc
aagatgaaggattcggacgcgcacattattaccgaccgcttccagcgcatcttcgtgcgt
gctgtggtgcggcaactcgaccacgatggcagcggctcgcgctctcagtacgatgcctac
ccgggccccgagcgctcgctagtcgatgcactgaacgctctggaagtgaacctgtccaac
cctctggttaagaagtcgtcgctgccgaccaagaacaaccacgtgtacttgaacatcctg
cctcaggccattgtagacccacagtacctggagggtgtgatccgtatcctcgcgtaccgc
tacgctgagcgtctggagcagctgggtgtgtccacggtagaactcaagatcatcgctcgc
ttcaacagcgaggcgccggcaatcccggtgcgtcttgtggctgagaacccgaccggttac
gtggtgcgcgtgcaggcgtacgtcgaggctgctggccacgatgagcctatctttacgtcg
atcggtgacgagacgcacggcgagctggacggcatgccggtcacgacgccgtatccggtg
gtattcccgttcgacaagaagcgtcagatggccaaggccatgtccaacacggtgtatgtg
tacgacttcttggagctcatcgagtacaacttgctgcgtcagtggcgcaagtacgtgcag
cagcgtacgcgcggtggcggctccaagatcaccatcccgaacttgttgatggagacgcgt
gaactgatcctggacgcgacgggcaaggcgctgacggagacgacgcgtctgcgcggccag
aacgacatcggtatggtggcgtggctgctgacgctgtacacgccggagttccaggatgga
cgtgagatcatcattatcgctaacgacatcacgttcaaggctggttccttcggtacccgc
gaggacacgttgttcgacctggcgtcgaagctggctcgttcgaagggcattcctcgcttc
ttcttctcggccaatgctggtgctcgcatcggcatggctgagtccatcaaggcgctgtat
aaggtatgctggaaagacgagaccaaccccattaagggctttgagtacctgtacttgacg
cctgaggattacaaggttgcgtcggccgagggctccgttaacgctaaactgctggtcacc
agcacgggtgaagaacgctatgtgctgaacgacatcgtcggtcgcgagatcgatcttggt
gtggagtgtctgcgcggtagtggtacgattgccggcgaaacgtctcgcgcctatcaggac
gtgtttacgctgacgtacgcctgcggccgcagtgttggcatcggtgcctacctggtccgt
ctgggccagcgtacggtgcagaacgccacgcactctccgatcatcctgacgggctaccag
gctctgaacaagcttatgggtaaggatgtgtacacctcgaacgaccagcttggtggtgtg
aagatcatgcacacgaacggtgtgacgcacttgacggcgaagaaccacctgtcgggcatt
tactctatccttgagtggctgagctttgtgccggcggtgcgtcgcggtccgcttccgatc
cgcgacctcacgggcgtggatgagatcgaacgtacggtggacttttgccccgcagacaag
agtacgcagtacgatccgcgtgcgttgctcgcgggtaaggtggatgaggcgacgggcaag
tgggtgtccggtcttatggacaaggactcgttccgcgagacgcttgacggctgggccaag
agcgtaatcgtcggacgtggtcgtcttggtggcattccgtgcggtgtggtcgtcacggag
gtgcgtacgtccgagaaggtgatcccggctgacccggcgtccccggcgtcgcaggagaac
ctgatgcagcaggctggccaggtgtggttcccggattcggctcacaagacggctactgcc
atcaaggacttcaagggcgaggacctgccgcttttcatcctagccaactggcgtggtttc
tccggtggccagcgcgacatgttcgacgaggtgctcaagttcggcgctgctattgtggac
ggtctcgtcaactacgagcagcccgtgttcgtgtacatcccgccgttcgctgagctgcgt
ggtggcgcctgggccgtggtggaccctaccatcaacgagggtatcatggagatgtacgcc
gacccgcagggccgcggtggtgtgttggagccggccggtctgattgagatcaagtaccgc
aaaaagcagcttcttcagaccatgcaccgtctggatgacaagctaaagcagctcacagct
cgtctgggtgagctgtcgcctgaggagaaggcaactgaaggcgccaaaatttcggctgag
atcaagacgcgcgaggaaactctcctgcccatctacgtgcaggtggcgacggagttcggc
gacctgcacgacacgcctggccgtatgaagtccgtgggctgcattcgtcaagtggtgccc
tggtcgaactcgcgtaggttcttctactggcgtctcaagcgtcagcttgctgagttcacg
ctgcgtcgccaggtggttgcagccagcgccggtggtccgcgcgccacgacattcgtgggc
tcggagcaggtgctgaagggctggttcactgaggctgtgaacggcggtcgtgtgccgcgt
cagcagaacgtgtcggtgtccgagctgtggtctcacggcgactcggacgtgttgctgtgg
ctgtcgagtgacaaggagtggatcgcgtcgcgcgtggctgagctgcgtcaggagcagatg
gcgtcgcaggttgtcgagatcggacggaaggaccccaaggctgccgtggccggtattctc
gaggtgctcaacctgctgagcgacaaagaccgcgaggaagcgctgaacgctctgcgtcgc
ggctccatcttccacaagtaa

DBGET integrated database retrieval system