KEGG   Phytophthora infestans: PITG_21393Help
Entry
PITG_21393        CDS       T01333                                 

Definition
(RefSeq) eukaryotic translation initiation factor 3 subunit A, putative
  KO
K03254  translation initiation factor 3 subunit A
Organism
pif  Phytophthora infestans
Pathway
pif03013  RNA transport
Brite
KEGG Orthology (KO) [BR:pif00001]
 09120 Genetic Information Processing
  09122 Translation
   03013 RNA transport
    PITG_21393
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03012 Translation factors [BR:pif03012]
    PITG_21393
Translation factors [BR:pif03012]
 Eukaryotic type
  Initiation factors
   eIF-3
    PITG_21393
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: US30
Motif
Other DBs
NCBI-GeneID: 9463342
NCBI-ProteinID: XP_002895035
UniProt: D0P3U0
AA seq 1154 aa AA seqDB search
MSHFFHKPENALKRARELLAIPNVDAGVLKRTKHSALEILHDALIAKKNRTWQPTHEELM
ILYLDICLELQMGRVAKDGLHQYRNLCIQHNPASLETIIKHFVTQAERKLAAAKKESNEL
NLLAAAKVDLDAAQTPEDVMLSTTTFEGSNDRTDREVVVPWLRFMWETYRTVLDILKSNS
KLEPLYKTTAMQAFDFCVEYQRKIEFRRVCEIMRNHLSALQKHVAAPTSQSTRQMRSWEG
FTLDSVERLLEVRYRQLQVATDLELFSEAFRTIDDINNIMNLVEQTPRVDLLVTYYEKLA
QIFQVSKNHLFHAYALYKWYSLRVAGLQGLAGSQALQELPVLVSEGEQKEMATRVVLAAL
SIPLLDFEASSSVLGDDETSAAQTAESSLSAAARDKNARMAALLGFSTTPTRANLLEDIE
AAGILPKASTAASEIFQRVELQEVDPLQIVKQLEPFLTKIRADPLAKAYVDGVERLVVRR
VLFQLTRVYASVTITHLRSIFVGLDISYEEIETLIARSRSLSTVAHTSAPSLSGMYRRNV
TQHGSNNAETSSADAVASAQTRTKIRIDHVEQCIRFTDAVDLEANAAQLTLLGERLSRAM
SKQKKKLLASTRARLQSQRSEMLARREIIERKKEELEKLQQEKLQSLEKKRREFAKRRAE
LERERLTQEARRREADKKQKIQDEIKLKETRQMLDKLGHTNVSDMDLATIDKEKVLNEAK
EKARKAKELAQQKLRENARRLDYIVRATREEEQPILQRQAAEAKAEALKRYEEESAAKLK
RAKEEHEHGLKEKARLAPAIEASAEFVKAHKARRIEEYKKASEEQKKKAMLERLSARVAH
AKERYEEEQRCLREEEEEKERIRREEEAERERQRLIQVEEELRRQEEEEAEERRIAEEKE
REERSQRQREEEEKRVEQRSQGRFGSAGARGLSGSYRDSNRSRDDDHRGDDRNDGEWTQV
SRGGPSSRAQTVAPEGRWERRGPTARESFGDRDGRESGGLRRDFGGDRDSGSRRGFGGDR
DERESGVRRAFGGDREDREGGLRRGFGGDREESGSRWGSRESFRRSGDRDGDRESFRRGG
DRDGDRESFRRGGDRDGERDSFRRGADRDGDDRFFGRSQREGSYRAPRAGERDNSSCAGD
RDSSSRAPESGRWR
NT seq 3465 nt NT seq  +upstreamnt  +downstreamnt
atgtcgcacttcttccacaagccggaaaatgctctgaagcgcgcgcgtgagttgttggcc
atccccaacgtggacgccggggtgctcaagcgtaccaagcactcggcgctcgagatcctg
cacgatgcgctcatcgccaaaaagaaccgcacgtggcagcccactcacgaggagctcatg
atcctgtacctggacatttgtctagagctgcagatgggccgcgtagccaaggacggtctt
caccagtaccgcaacctgtgcatccagcacaacccggcgtcgctcgagaccatcattaaa
cacttcgtcacgcaggctgagcgcaagcttgcggcagccaagaaggagagcaacgagctc
aatcttctggccgctgccaaggtggatctggacgctgcgcagacgcctgaggacgtgatg
ctgtccaccaccacttttgagggatccaacgaccgcactgaccgcgaagtggttgttcca
tggcttcgatttatgtgggagacgtaccgcacggttctggacatcctcaagagcaactcg
aagcttgagccgctgtacaagaccaccgctatgcaagcgttcgacttttgcgttgaatac
cagcgcaagattgagttccgtcgcgtttgtgagatcatgcgcaaccacctgagcgctttg
cagaagcacgtggcggcgcccacgagccaatcgacccgccagatgcgcagctgggaagga
ttcactctcgatagcgtcgagcgtctgctggaagtgcgttatcgtcagctccaggtcgct
accgacctcgagctcttctcggaggccttccgtacgatcgatgacatcaacaacattatg
aacttggtggagcagaccccgcgcgtggaccttctcgtcacgtactacgagaagctggcg
cagattttccaggtgtccaagaatcacctcttccatgcctacgcgctgtacaagtggtac
tcgctgcgtgtggctggtctgcagggcctcgctggctcccaggctctacaagagctgcct
gtgctggtttctgagggtgaacagaaggaaatggccacacgcgttgtgcttgctgctcta
tctattccgctactggactttgaagcgtcttcgtctgttcttggagatgacgagacatcg
gctgcccagaccgccgagagctccctctctgctgctgctcgtgacaagaatgcgcgaatg
gctgctctgttgggcttttccactacgcctacgcgtgctaacctgctcgaggacatcgag
gccgctggcatcctccccaaggcttccactgctgccagtgagatcttccagcgtgtggag
ctgcaggaagtggaccctctgcagattgtgaagcagttagagcctttcctgaccaagatt
cgtgctgatccgctagccaaagcctacgtcgatggtgttgagcgccttgtggtgcgtcgt
gtgctgttccagctcacccgcgtgtacgctagtgttacgatcacccacctgcgctctatc
ttcgtcggcctcgatatttcttacgaggagattgagacccttattgctcggtcgcgtagt
ctcagcaccgtcgcgcataccagtgcacctagtctgtccggcatgtaccgccgtaatgtt
acgcagcatggcagcaacaacgccgagacgtcatcagccgacgctgtggcgtctgctcag
acgcgaactaagatccgcatcgaccatgtggagcagtgcattcgcttcactgacgctgtg
gatctggaggccaatgctgcccagctgacgcttctgggtgagcgtctgtcccgtgctatg
agcaagcagaagaagaagctccttgcgtctacccgtgctcgtctgcagtcacaacgctcc
gagatgctggctcggcgtgagattattgagcgtaagaaggaagagctggagaaactgcag
caggagaagctccagtcgctcgagaagaaacggcgggagtttgcaaagcgtcgcgccgag
ctcgaacgcgagcgtctgacccaggaagctcgtcgccgtgaggccgacaagaagcagaag
attcaggatgagatcaagcttaaggagacccgtcagatgttggacaagctgggccacact
aatgtgagcgacatggacctcgcaacaatcgacaaggagaaggtactgaacgaggctaag
gagaaggctcgcaaggccaaggaacttgcccagcagaaactgcgcgagaatgctcgtcgt
ctcgactacattgtacgtgctactcgcgaggaggagcagcccattctgcagcgccaggct
gccgaagccaaggcggaggctctgaagcgctacgaagaggagtcggctgccaagcttaag
cgtgctaaggaggagcacgaacacggcttgaaggagaaggctcgcctggccccggctatc
gaggcgagcgccgagttcgttaaggctcacaaggctcgtcgtattgaggaatacaagaag
gcttcggaggagcagaagaagaaggccatgctggagcgtctgagtgcccgcgtggctcac
gccaaggagcgctacgaggaggagcagcgctgtctgcgtgaggaggaagaggagaaggaa
cgcatccgtcgcgaggaagaagccgaacgtgaacgccagcgcctgattcaggtggaggag
gagcttcgtcgccaggaggaggaagaggctgaggaacgtcgtattgctgaagagaaggag
cgtgaggagaggagccagcgtcagcgcgaggaggaagagaagcgtgtcgaacagcgcagc
cagggtcgattcggcagcgctggtgctcgtggcctgtccggcagctaccgcgattcgaac
cgcagccgtgatgacgaccaccgtggcgacgacaggaacgatggagagtggacgcaagtt
agccgtggtggtccttccagccgtgctcaaacagtggcacctgaaggccgctgggagcgt
cgtggacctaccgctcgcgagagtttcggcgaccgcgacggacgcgagagcggtggcctt
cgccgcgacttcggtggtgaccgtgacagtggttctcgtcgtggatttggtggtgatcgg
gatgagcgtgaaagcggcgtgcgtcgtgcttttggcggtgatcgcgaggaccgtgagggc
ggtctgcgccgtggcttcggtggcgaccgcgaggagagtggttctcgctggggcagccgc
gagtcgttccgccgtagtggtgaccgtgatggcgaccgtgaatcttttcgtcgcggcggg
gaccgtgatggcgaccgtgaatctttccgtcgtggtggtgaccgcgatggcgagcgcgac
tcgttccgtcgtggagccgaccgtgatggagatgaccgtttctttggtcgctcacagcgt
gaaggttcttatcgcgcgcctcgcgctggtgaacgcgataattcgtcttgcgctggtgac
cgcgatagttcgtctcgcgctcccgagtctggccgctggagatag

DBGET integrated database retrieval system