KEGG   Pigmentiphaga sp. H8: EGT29_00795Help
Entry
EGT29_00795       CDS       T05719                                 

Definition
(GenBank) amidase
  KO
K02433  aspartyl-tRNA(Asn)/glutamyl-tRNA(Gln) amidotransferase subunit A [EC:6.3.5.6 6.3.5.7]
Organism
pig  Pigmentiphaga sp. H8
Pathway
pig00970  Aminoacyl-tRNA biosynthesis
pig01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pig00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    EGT29_00795
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:pig03029]
    EGT29_00795
Enzymes [BR:pig01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.6  asparaginyl-tRNA synthase (glutamine-hydrolysing)
     EGT29_00795
    6.3.5.7  glutaminyl-tRNA synthase (glutamine-hydrolysing)
     EGT29_00795
Mitochondrial biogenesis [BR:pig03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    EGT29_00795
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Amidase
Motif
Other DBs
NCBI-ProteinID: AZG06515
UniProt: A0A3G8GEG6
Position
complement(166609..168006)
Genome map
AA seq 465 aa AA seqDB search
MSDLPFLSLAQLAHAFERKEISPVEALESQLARIAALNERINAFTILDEDRARAAARASE
SRWQRGAPLGPLDGVPFTAKDNLMVAGLPHRRGSRAMPADPVADTAPAVLRCQEGGAVLL
GLTTMPELGAGPVTISPLTGATTNPWDTAKQAGGSSGGGAASVSAGFCPFALGSDAGGSL
RIPAALTGVVGFKATGGLVPMYPPNVAGGLSCVGPLARNVRDTATVLDIIARPDPRDAMS
LPWRPDGLGADLELGLRGKRVALSLTLGYAPRVDAEIAQAFGQMGRRLADLGAIVEEADP
DIDNPIDDYLVLLQAGYRYALQHMPAERRALLSPVMAGILEDGAGLALEDYMGAQARCQD
LARRLHAFHQRFDLLLTPTVAAPAFDANLSYPKEFEEFPNRRAWTPYTSLFNLTQQPAIS
IPMGLTAAGLPMGLHIAAPRGHDAQVLQAAHALEAVLGFEARPPI
NT seq 1398 nt NT seq  +upstreamnt  +downstreamnt
atgtcagacctgccgttcctttcccttgctcagctcgcccacgccttcgaacgcaaggag
atctctccggtcgaggcgctcgaatcgcagcttgcccgcatcgccgcactgaacgagcgc
atcaacgcgttcacgatcctggacgaggaccgcgcccgcgcggcggcccgcgccagcgag
tcgcgctggcagcgcggcgcgccgctcggaccgctggacggggtgcccttcaccgccaag
gacaacctgatggtggccgggctgccccaccggcgcggctcgcgcgcgatgcccgccgac
cccgtggcggacaccgcgcccgcggtgctgcgctgccaggaaggcggcgcggtgctgctg
ggcctgaccaccatgccggaactgggcgcgggtccggtcaccatcagtccgcttaccggc
gccaccaccaatccctgggacacggccaagcaggccggcgggtcctcgggcggcggcgcg
gcctcggtgtcggccggcttctgccccttcgcgctgggctcggacgccggcgggtcgttg
cgcattcccgcggccctgaccggcgtggtcggcttcaaggccacaggcggcctggtgccc
atgtatccgcccaacgtggccggcggcctgtcctgcgtcggcccgctggcccgcaacgta
cgggacaccgccacggtgctggacatcatcgcccggcccgatccgcgcgatgccatgtcg
ctgccctggcggcccgacggcctgggcgccgatctcgaactaggcctgcgcggcaagcgc
gtcgccctcagcctgaccctgggctacgccccccgggtcgacgccgagatcgcccaggcc
ttcggccagatgggacgacgcctggccgacctgggcgccatcgtcgaagaagccgatccg
gacatcgacaatcccatcgacgactacctggtcctgctgcaggcgggataccggtacgcg
ctgcagcacatgccggcggagcggcgcgcgctgctgtcacccgtcatggccggcatcctg
gaggacggcgccggcctggcgctggaggactacatgggtgcgcaggcgcgctgccaggac
ctggcgcggcgcctgcacgccttccaccagcgcttcgacctgctgctgacgcccacggtc
gcggcccccgccttcgacgcgaacctgagctatccgaaggagttcgaggaattccccaac
cggcgggcctggacgccctacacctcgctgttcaacctgacgcagcagcccgccatcagc
atcccgatgggactgaccgccgccggcctgcccatgggcctgcacatcgccgcgccgcgc
ggccacgatgcccaggtattgcaagcggcgcacgcgctggaagcggtgctgggattcgag
gcgcgcccgccgatctga

DBGET integrated database retrieval system