KEGG   Pigmentiphaga sp. H8: EGT29_16235Help
Entry
EGT29_16235       CDS       T05719                                 

Definition
(GenBank) glucose-6-phosphate dehydrogenase
  KO
K00036  glucose-6-phosphate 1-dehydrogenase [EC:1.1.1.49 1.1.1.363]
Organism
pig  Pigmentiphaga sp. H8
Pathway
pig00030  Pentose phosphate pathway
pig00480  Glutathione metabolism
pig01100  Metabolic pathways
pig01110  Biosynthesis of secondary metabolites
pig01120  Microbial metabolism in diverse environments
pig01130  Biosynthesis of antibiotics
pig01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:pig00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00030 Pentose phosphate pathway
    EGT29_16235
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    EGT29_16235
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:pig04147]
    EGT29_16235
Enzymes [BR:pig01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.49  glucose-6-phosphate dehydrogenase (NADP+)
     EGT29_16235
    1.1.1.363  glucose-6-phosphate dehydrogenase [NAD(P)+]
     EGT29_16235
Exosome [BR:pig04147]
 Exosomal proteins
  Exosomal proteins of breast cancer cells
   EGT29_16235
  Exosomal proteins of colorectal cancer cells
   EGT29_16235
  Exosomal proteins of bladder cancer cells
   EGT29_16235
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: G6PD_C G6PD_N
Motif
Other DBs
NCBI-ProteinID: AZG09283
UniProt: A0A3G8GM36
Position
complement(3433997..3435514)
Genome map
AA seq 505 aa AA seqDB search
MNRQAPAAALQPAPRCTLVIFGATGDMTGRLLMPALYNLARFNLLHADFHVIGVGHRKLD
DDEFRRGLKHSMEQVVASRGGQATASFDAQAWDWLMGRTSFLMGDFEGEQTYAQLATLLA
PEPGGVIFYFATAPTFFQSIARHLHDAGLLKQGHGRWRRVVIEKPFGRDLPSARELNKQL
TRVVHENQIFRIDHFLGKETVQNIMVSRFANSVFESNWNRLYIDHVQITAAEAIGVERRS
QFYEQTGALRDMVPNHLFQLLAMVAMEPPNSFDADAVRTEKEKLLDAIRIQTPAEALQNS
VRGQYRAGLVGGQPMRGYREEEGVAPDSRTETYVALKLGIDNWRWGGVPFYLRTGKALAR
RQTQIVIAFKDAGHALFRQNAQEKPPANSLVLQIQPDEGLFFHMKAKVPGSKIRIAPVSM
DFRYADHFMTGHSSGYETLIYDCMVGDATLFQRAADIELGWEAVMPFLQAWEEGGEIHPY
RAGSQGPVPADVLLARDGRQWLPLD
NT seq 1518 nt NT seq  +upstreamnt  +downstreamnt
atgaacaggcaggcgcccgcggcggcgctgcagcctgccccgcgttgtaccctggtcatc
ttcggcgcgaccggcgacatgaccggccgcctgctgatgccggcgctgtacaacctggcc
cgcttcaacctgctgcacgccgacttccacgtcatcggcgtcggccaccgcaagctggac
gacgacgagttccggcgcgggctgaagcattccatggagcaggtcgtcgcctcgcgcggc
gggcaggccacggccagcttcgacgcccaggcctgggactggctgatgggccgcacgtcc
ttcctgatgggcgatttcgagggcgagcagacctacgcccaactcgccaccctgctggcg
cccgagccgggcggggtcatcttttatttcgccaccgcgcccacgttcttccagtccatc
gcgcgccacctgcacgatgccgggttgttgaagcaaggccatggccgctggcgccgcgtg
gtgatcgagaagccgttcggccgcgacctgccctccgcgcgcgaactgaacaagcaactg
acgcgggtcgtgcacgagaaccagattttccgcatcgaccatttcctgggcaaggaaacg
gtgcagaacatcatggtgtcccgcttcgccaacagcgtgttcgaaagcaactggaaccgg
ctgtacatcgaccatgtccagatcaccgcggccgaggcgatcggggtggagcgccgctcg
cagttctacgagcagactggagcgctgcgcgacatggtgcccaaccacttgttccagctg
ctggccatggtggcgatggagccgcccaattccttcgacgccgatgccgtgcgcaccgag
aaggaaaagctgctggacgccattcgcatccagacgccggccgaggcgttgcagaacagc
gtgcgcggccagtaccgcgcgggcctggtgggcggccagcccatgcgcggctaccgcgag
gaagaaggcgtggcgccggacagccggaccgagacctacgtggcgctcaagctgggcatc
gataactggcgctggggcggcgtgccgttctacctgcgcaccggcaaggcgctggcacgg
cgccagacgcagatcgtcatcgccttcaaggacgctggccacgcgttgttccgccagaac
gcgcaggagaagccgccggccaattccctggtgttgcagattcagcccgacgaggggctg
ttcttccacatgaaggccaaggtgccggggtccaagatccgcatcgcgccggtcagcatg
gatttccgctacgccgatcatttcatgaccgggcacagctcgggctacgagacgctgatc
tacgactgcatggtgggcgacgcgacgctgttccagcgggcggccgacatcgagctgggc
tgggaggcggtgatgccgttcctgcaagcctgggaggagggcggcgagatccatccctac
cgcgccggcagccaggggccggtgccggcggatgtgctgctggcccgcgatgggcggcag
tggctgccgctggactag

DBGET integrated database retrieval system