KEGG   Pigmentiphaga sp. H8: EGT29_20410Help
Entry
EGT29_20410       CDS       T05719                                 

Definition
(GenBank) alkaline phosphatase
  KO
K01113  alkaline phosphatase D [EC:3.1.3.1]
Organism
pig  Pigmentiphaga sp. H8
Pathway
pig00790  Folate biosynthesis
pig01100  Metabolic pathways
pig02020  Two-component system
Module
pig_M00126  Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:pig00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    EGT29_20410
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    EGT29_20410
Enzymes [BR:pig01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.1  alkaline phosphatase
     EGT29_20410
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PhoD PhoD_N Pur_ac_phosph_N
Motif
Other DBs
NCBI-ProteinID: AZG10031
UniProt: A0A3G8GP48
Position
4324626..4326431
Genome map
AA seq 601 aa AA seqDB search
MTDTLARRRFLRGVALGGAGAASTLALAACGGGDDDHPTDVSFTHGVASGDPLADRVVIW
TRAVPAGGGDVDIEWEMATDEAFRNIAKNGSASARADQDHTVKIDVTGLAAGTSYWYRFK
HEDKVSGVGRTRTLPTGSVKQVKLVVFSCSNYPAGYFHVYAEAAKRGDLDAAIHLGDYIY
EYGRDGYASEQAQAMGRPSEPANEIVSLADYRRRYAQYRSDPDLQAVHAALPFIAVWDDH
EIANDTWENGAENHQPDSEGDFALRKAAAVRAYHEWLPTRPQSAPNVIYRSFDFGNLLSL
HMLDTRVLARARQLSYASYFGALLGSPDPATGLAQFAAAFTADVAAPDRQLMGQAQTAWL
RDRMASSSATWQVLGQQVLMAPVHLPMPVLLGLLASTGQLGDVEIPAQFAMDPAAYARLV
ARQQAGDPTLTAQERAILAMPCIPYNLDSWDGYWAARETVLGMARQLDKNLVVLAGDTHN
AWASDLRDKDGNAVGVEFAASSVTSPGFEEYLGDGVPPAQLAALLTGLANLSTLPAGNKW
AGSLKYADTSLRGYMVLTVTPERIRADWQYVDTVHARGYRASLGQSLATLPGAANRKLVE
L
NT seq 1806 nt NT seq  +upstreamnt  +downstreamnt
atgaccgatacccttgcgcgccgccgcttcctgcgcggcgtcgccctgggcggcgccggc
gccgcctctaccctggccctggccgcctgcggcggcggcgacgacgaccatcccaccgac
gtcagcttcacccacggcgtggccagcggcgatccgctggccgaccgcgtcgtcatctgg
acccgcgccgtcccggccggcggcggcgacgtcgacatcgaatgggaaatggccacggac
gaggccttcaggaacatcgccaagaacgggtcggccagcgcccgcgccgaccaggaccat
accgtcaagatcgacgtcaccggcctggccgcgggcacgtcctactggtaccgcttcaag
cacgaagacaaggtttccggcgtcggccgcacccgtaccctgcctactggctcggtcaag
caggtcaagctggtggtcttctcctgttccaactaccccgccggctatttccacgtctat
gccgaggcggccaagcgcggcgacctggatgccgccatccacctgggcgactacatctac
gaatacggccgcgacggctatgcctcggaacaggcgcaggccatgggccggccgtccgaa
ccggccaacgagatcgtgtcgctggcggactaccgccgccgctatgcccagtaccgcagc
gaccccgacctgcaggcggttcatgccgccctgcccttcatcgccgtctgggacgatcac
gagatcgccaacgacacctgggaaaacggcgccgagaaccaccagcccgactccgagggc
gacttcgcgctgcgcaaggcggccgcggtgcgcgcctaccacgagtggctgcccacccgt
ccgcagtcggcgcccaacgtcatttaccgcagcttcgacttcggcaacctgctgtcgctc
cacatgctcgacacgcgcgtcctggctcgcgcccggcagttgtcctacgccagctatttt
ggcgcgctgctcggcagtcccgaccccgcgaccgggctcgcgcagttcgccgccgcgttc
accgccgacgtcgccgcgcccgatcgccaactgatggggcaggcccagaccgcctggctg
cgcgatcgcatggcctcgtcgagcgcaacctggcaggtcctgggtcagcaggtgctgatg
gcgccggtgcacctgcccatgccggtcctgctgggcctgctggcctccacgggccagttg
ggcgacgtcgagatccccgcccagttcgcgatggaccccgcggcctacgcccggctcgtc
gcccggcagcaggccggcgatccgaccctgacggcgcaggaacgcgccatcctggccatg
ccctgcatcccgtacaacctcgactcctgggacggctactgggccgcgcgcgagaccgtg
ctgggcatggcgcgccagttggacaagaacctggtcgtgctggccggggatacccacaac
gcctgggccagcgacctgcgcgacaaggacggcaacgccgtgggcgtggagttcgccgcg
tcgtcggtgacctcgcccggcttcgaggaatacctgggcgacggcgtgccgccggctcaa
ctggctgccctgctgaccggcctggccaacctgtccaccctgcccgcgggcaacaagtgg
gcgggcagcctgaagtacgccgacaccagcctgcgcggctacatggtcctgaccgtcacg
cccgagcgcatccgcgccgattggcaatacgtcgacacggtgcatgcccgcggctatcgc
gcatcgttgggccagagcctcgccacgctgccgggtgcggccaaccgcaagctggtcgaa
ctctga

DBGET integrated database retrieval system