KEGG   Paenibacillus sp. IHBB 10380: UB51_04785Help
Entry
UB51_04785        CDS       T03836                                 

Definition
(GenBank) methionyl-tRNA synthetase
  KO
K01874  methionyl-tRNA synthetase [EC:6.1.1.10]
Organism
pih  Paenibacillus sp. IHBB 10380
Pathway
pih00450  Selenocompound metabolism
pih00970  Aminoacyl-tRNA biosynthesis
pih01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pih00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    UB51_04785
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    UB51_04785
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:pih01007]
    UB51_04785
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:pih03016]
    UB51_04785
Enzymes [BR:pih01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.10  methionine---tRNA ligase
     UB51_04785
Amino acid related enzymes [BR:pih01007]
 Aminoacyl-tRNA synthetase
  Class I (U)
   UB51_04785
Transfer RNA biogenesis [BR:pih03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    UB51_04785
 Prokaryotic type
   Other AARSs
    UB51_04785
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: tRNA-synt_1g tRNA-synt_1 tRNA_bind tRNA-synt_1e Anticodon_1 tRNA-synt_1f DNA_ligase_ZBD
Motif
Other DBs
NCBI-ProteinID: AJS61395
UniProt: A0A0D3VGS8
Position
1086388..1088361
Genome map
AA seq 657 aa AA seqDB search
MTEKKTFYLTTPIYYPSDKLHIGHAYTTVAGDALVRYKKLRGYDVRYLTGTDEHGQKIER
KAAEAGKTPQKFVDDIVAGIQDLWRKLDISNHDFIRTTEERHTKVVQDVFERLLKQGDIY
KGEYEGWYCTPDESFFLERQLVNGNCPDCGRPVERVKEESYFFKMSKYVDRLLKYYEEHP
DFIQPVSRKNEMINNFIKPGLEDLAVSRTTYDWGIKIKSDPKHVIYVWIDALLNYITALG
YGSEDTTLFDKYWPADVHLMSKEIVRFHTIYWPIILMALDLPLPKKVFAHGWLLMKDGKM
SKSKGNVVDPVTLIDRYGLDSLRYYLLREVPFGSDGTFTPESFVERVNSDLANDLGNLLN
RTVAMVDKYVDGQVPAYQANVTAFDNSLVEAAQAAYDKVESSMENMEFSVALTAISQFVS
RSNKYIDETQPWTLAKDESKVNELASVMTHLVESLRIASILLQPFLTQAPTKMWEQLGLE
EGEFTSWDSGKTFGLFPEGTKLVKGSPIFPRLDPEQEIAYIAEAMTGGMKAAEALAKAEV
NHDDEPIEHKEEIGIEDFTKVELRVAQVLAAEPVKKADKLLKLQLDLGFEQRQVVSGIAK
FYTPEELVGRKVICVVNLKPVKLRGELSQGMILAASHGDQLTLATVPENMPNGAIVK
NT seq 1974 nt NT seq  +upstreamnt  +downstreamnt
atgacagagaagaaaacgttttatttaacaacccctatatactaccctagtgacaagcta
catattggtcatgcatacacaaccgtagctggagacgctctagtgcgttacaagaagctt
cgtggctacgatgtgcgttatttaacagggacagatgagcatggtcagaagattgaacgt
aaagccgctgaggcgggtaaaacaccacagaaatttgttgacgatattgtcgctggaatt
caagatttgtggcggaagctagatatctctaatcatgattttatccgcacgacagaagaa
cgtcacacgaaagttgtacaagatgtatttgaacgtctattgaagcaaggtgatatttat
aagggtgaatatgaaggttggtattgtacacccgatgaatcctttttcctagagcgtcag
ctggtcaatgggaattgtccagattgtggacggcccgtggaacgagtgaaggaagaaagt
tatttcttcaaaatgagtaaatatgttgatcgacttctcaagtattacgaggaacatcca
gatttcattcagcctgtatctcgtaagaatgagatgattaataactttattaagccagga
cttgaagatttggctgtgtcacgtacgacatatgattggggaattaaaataaagagtgat
ccgaaacatgtgatttatgtatggattgatgctttactcaactatataacagcactgggc
tatggttctgaggatactacattatttgacaagtattggcctgctgacgttcatctaatg
agtaaggagatcgtgcggttccatacaatctattggccaattatattgatggctctagat
ttgccgttgccgaagaaagtatttgcacacggctggttattaatgaaagatggcaagatg
tctaaatccaaagggaacgttgttgaccctgtgacattgattgatcgttatggtctcgat
tcactacgttactatcttcttcgcgaagttccttttggttcagatggtacatttacacca
gaaagttttgttgaacgtgtgaattcagatttagcgaatgaccttggtaacttgttaaat
cgtaccgtggccatggtggataaatatgttgacgggcaagtaccagcctatcaggcgaat
gtgacagcgtttgataactctctagtagaagcggctcaggcagcatatgataaagtggaa
tcatccatggagaacatggagttctctgttgctcttacagccattagtcagttcgtaagc
cgaagcaataaatatattgatgagacacaaccttggacgcttgcgaaagatgaatctaaa
gtgaatgagctggcttctgtgatgactcatcttgtggaaagcttgagaattgcctccatc
ttgctgcagcctttcttgactcaagcaccgacaaaaatgtgggagcagcttggattagaa
gaaggtgagttcacttcgtgggatagtggtaaaacgtttggactatttccagaaggcacg
aaactggtaaaaggaagcccaattttcccacgtcttgatcctgaacaggaaattgcttat
atagcagaagctatgactggtggaatgaaggcggcagaagctctagctaaagcggaagtg
aatcatgatgatgagccgatagaacacaaagaagaaatcggcattgaggacttcactaag
gttgaacttcgtgtggctcaagtgctcgctgctgaacccgttaaaaaagcagataagtta
ttgaagcttcaacttgatctaggatttgagcaacgtcaagtggtatcgggcattgcgaaa
ttctacacaccagaagagttggtaggtcgtaaagtgatttgtgtagtgaacctgaagcct
gtgaaattgcgtggggagttgtctcaaggtatgattcttgctgcttcgcatggagatcag
cttacattggcaactgttcctgagaacatgcctaatggtgctattgtcaaataa

DBGET integrated database retrieval system