KEGG   Paenibacillus sp. IHBB 10380: UB51_07215Help
Entry
UB51_07215        CDS       T03836                                 

Definition
(GenBank) HAD family hydrolase
  KO
K01101  4-nitrophenyl phosphatase [EC:3.1.3.41]
Organism
pih  Paenibacillus sp. IHBB 10380
Pathway
pih00627  Aminobenzoate degradation
pih01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:pih00001]
 09100 Metabolism
  09111 Xenobiotics biodegradation and metabolism
   00627 Aminobenzoate degradation
    UB51_07215
Enzymes [BR:pih01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.41  4-nitrophenylphosphatase
     UB51_07215
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Hydrolase_6 Hydrolase_like Hydrolase HAD_2 Hydrolase_3 PreAtp-grasp
Motif
Other DBs
NCBI-ProteinID: AJS58322
UniProt: A0A0D3V9F1
Position
1606260..1607048
Genome map
AA seq 262 aa AA seqDB search
MKQIKGLLIDLDGTLYHGNHMIPGADVLIDTLKSRHIPYLFVTNNSSRTPQSVAALLNGM
GIQAAPEDICTSSQATAKYIAQKSPGARVLILGEDGLRDALLGAGLQEVDESPQYVVQGI
DRTFTYASLSEAVRWINEGAISILTNPDLRLPSDHGFIPGAGTIGAAIEAGSGVKPIVIG
KPSSHLMTYATDLLNLHPSEVTVMGDNMHTDIAAGAAAACETVLVLTGITTEENLQQHIE
ATGIQPDAVCKDLQEALQLLCP
NT seq 789 nt NT seq  +upstreamnt  +downstreamnt
atgaaacagattaaagggttactaatcgatttggatggtacactttatcatgggaatcac
atgattcctggagctgacgttctaattgatacattgaagtctcgtcatattccttattta
tttgtaacgaataattcttctcgaacaccacagagtgttgctgcattacttaatgggatg
ggaatccaagcagcaccggaagatatatgtacttcttcacaggcaacggcaaagtatatt
gctcagaagtctccaggagcaagagtgctaatccttggagaagatggactacgtgatgca
ttactaggtgcaggattgcaagaggtagacgaatccccacagtatgtagtgcaaggaata
gatcgaacatttacatatgcttcattatcagaagcagttcgatggattaatgaaggtgcg
atctccattcttaccaatcctgatttaaggcttccatctgatcatggttttattcctgga
gctggaacgataggtgcagccattgaagcgggatcaggggttaagcccattgtaattggt
aaaccctcaagtcatctaatgacttatgcaactgatttgttgaatttacatccatctgag
gttactgttatgggtgacaatatgcatacagatatcgctgctggagcggcggcagcatgt
gaaacggtactggtgcttacaggtatcacgacagaagaaaacctacagcagcatattgag
gcaacgggtattcaacctgacgctgtatgcaaagacttacaagaggcgctacagctctta
tgcccttga

DBGET integrated database retrieval system