KEGG   Paenibacillus sp. IHBB 10380: UB51_11670Help
Entry
UB51_11670        CDS       T03836                                 

Definition
(GenBank) glycoside hydrolase family 3
  KO
K01207  beta-N-acetylhexosaminidase [EC:3.2.1.52]
Organism
pih  Paenibacillus sp. IHBB 10380
Pathway
pih00520  Amino sugar and nucleotide sugar metabolism
pih01100  Metabolic pathways
pih01501  beta-Lactam resistance
Brite
KEGG Orthology (KO) [BR:pih00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    UB51_11670
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01501 beta-Lactam resistance
    UB51_11670
Enzymes [BR:pih01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     UB51_11670
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_3
Motif
Other DBs
NCBI-ProteinID: AJS61503
UniProt: A0A0D3VGT0
Position
complement(2673988..2675259)
Genome map
AA seq 423 aa AA seqDB search
MLMLMICILFITSCSTQAQSPSSTPNTGKAGSTSPDTLGNSENNTDGDTSEPVKEEDPII
LKMNKMTMEEKIGQMILAGVEGTELDARAKQMIAEEKVGGIILFSKNISDLNGTVKFIKD
LKQANADNPVPLFMSVDQEGGRVSRMPKELLSIPSNGRVGKTNNAVLAETMGKLLARELL
LTGFNVDFAPVLDVNSNPNNPVIGDRSFGNSASQVTKLGIAEMKGLRSEGVIPVVKHFPG
HGDTAVDSHLELPVVNKTLEQLKKLEWIPFEAAIKEEVEAVMVAHILFPKLDPDKPASLS
NAIIGQQLRGELNYKGVVITDDLSMGAIMKNFDLHDVTIDTVKAGSDILLVAHSYDRAKL
IFDTLMHSVKDGTISESRIDESVYRILSLKSRYQLADNLKPTGNMKDLNKDIETWRKQVN
ARK
NT seq 1272 nt NT seq  +upstreamnt  +downstreamnt
ctgcttatgctgatgatatgtattttatttataacaagttgttctacccaagctcaatcg
ccgtcttcaacacccaacacgggaaaagcggggtcaacatctcccgatactcttgggaac
tcagagaacaatactgacggggacacctcagaaccagtgaaagaggaagatccgattatt
ctaaaaatgaacaagatgactatggaagagaagattggtcaaatgatccttgcgggagtt
gaaggtaccgaactcgatgccagagctaaacagatgattgctgaagagaaggtgggcgga
atcattctgttttccaagaacatctcggacttgaatggtacggtaaaattcattaaagac
ttgaagcaggctaatgctgacaatcctgttcctctgttcatgagtgttgatcaggaaggc
ggtagagttagtcgtatgccgaaggaactactatctataccatccaatggcagagtcggc
aagacgaataacgcagttctagcggagacgatgggtaagcttctcgctcgggaacttctt
cttacagggtttaatgtggactttgcgcctgtactggatgtgaatagtaatccgaacaat
cccgtcatcggagatcgctcatttggtaactctgccagtcaggttacgaagctaggcatt
gccgagatgaagggattaagaagtgagggtgtcattccggtcgtcaaacattttcccgga
cacggtgatactgcggttgattcccatctcgaactgcccgttgtgaacaagacattggaa
cagcttaagaagctggaatggattcccttcgaagctgctataaaagaagaggtagaagcg
gtgatggtcgctcatattttatttccaaagcttgaccctgataagccagcttcgttatct
aatgcgatcatcggtcagcagctacgaggagaactcaactacaagggtgttgtgattact
gatgatctaagcatgggggcaattatgaagaactttgatctacatgatgtaacgattgat
accgtcaaggcaggaagtgatatattgcttgtcgcacatagttatgacagagcgaagctg
atctttgacaccctcatgcatagtgtgaaggacggaactatttcggaatcacgcattgat
gaaagtgtgtatcggatattgtcattgaagagtcgttaccagctggcggacaatttgaaa
ccaacagggaatatgaaggatctcaataaagacatcgaaacttggcgaaaacaggttaat
gctcgaaagtag

DBGET integrated database retrieval system