KEGG   Paenibacillus sp. IHBB 10380: UB51_17550Help
Entry
UB51_17550        CDS       T03836                                 

Definition
(GenBank) butanediol dehydrogenase
  KO
K00004  (R,R)-butanediol dehydrogenase / meso-butanediol dehydrogenase / diacetyl reductase [EC:1.1.1.4 1.1.1.- 1.1.1.303]
Organism
pih  Paenibacillus sp. IHBB 10380
Pathway
pih00650  Butanoate metabolism
Brite
KEGG Orthology (KO) [BR:pih00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    UB51_17550
Enzymes [BR:pih01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.4  (R,R)-butanediol dehydrogenase
     UB51_17550
    1.1.1.303  diacetyl reductase [(R)-acetoin forming]
     UB51_17550
    1.1.1.-  
     UB51_17550
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N Glu_dehyd_C ADH_N_assoc TrkA_N Peptidase_M50 Shikimate_DH 2-Hacid_dh_C
Motif
Other DBs
NCBI-ProteinID: AJS59975
UniProt: A0A0D3VD19
Position
complement(3893134..3894183)
Genome map
AA seq 349 aa AA seqDB search
MKALRWHGLKDLRLENIEEPTALPGKVKIKVEWCGICGSDLHEYTAGPIFIPEGASHPIT
GEKAPIVMGHEFSGKVVEVGEGVTKVNVGDRVVVEPIYSCGKCDACKTGYYNLCSTMGFL
GLAGGGGGFSEYVAAEEYMVHKIPDSVSYEQGALVEPSAVALHAVRQSKLKVGDKAVVFG
AGPIGLLVIEALKASGAAEIYAVELSAERKQKATELGAIVIDPKQYDVVEEIHKRTNGGA
DVAYEVTGVPPVLTQALNSTKVGGELMIVSIFEKEAPIKPNNIVMMERTIKGIIGYRNVF
PAVISLMAQGYFSAEKLVTKRIRLDEVVEEGFEALLKEKNHVKILVKAE
NT seq 1050 nt NT seq  +upstreamnt  +downstreamnt
atgaaagcattaagatggcatggactaaaagatttgcgtttagagaacattgaagaacca
accgctctaccaggtaaagtcaaaatcaaagtcgagtggtgcggtatttgcggcagcgac
ttgcacgaatatacagcaggtccaatcttcattccagagggtgcatcacatccaatcact
ggagaaaaggcccctatcgttatgggacatgaattttccgggaaagtcgtagaggttggc
gaaggtgtaaccaaagtgaacgttggcgatcgtgtcgttgtagaacctatctattcatgt
ggtaaatgcgatgcctgtaaaacaggttactataacctttgctccacaatgggcttcctc
ggtcttgcgggaggcggaggaggtttctctgaatacgtggctgctgaagaatatatggtc
cacaaaattccagatagcgtctcctatgagcaaggtgcacttgttgaaccttccgcagtt
gcacttcatgccgtccgtcaaagcaaacttaaagttggcgataaagctgtagtattcggt
gcaggtccaatcggcttgctcgttattgaagcattgaaagcctccggcgcagcagagatt
tatgctgttgagttgtccgccgaacggaagcaaaaagcgactgaacttggcgcaatcgta
attgatcctaaacaatatgatgttgtggaagaaatccacaaacgcacgaacggcggtgca
gacgtcgcttatgaagtcaccggtgttccccctgtccttacacaggcccttaattcgacg
aaagtaggcggcgaattgatgattgtcagcatttttgagaaagaagcgcctattaaacct
aataacattgttatgatggaacgcaccatcaaagggattataggttatcgcaacgtattt
cctgctgttatcagtttgatggctcaaggctacttctccgctgagaaacttgtaacgaaa
cggattaggcttgatgaagttgttgaagaaggctttgaagcacttttgaaagaaaaaaat
catgtgaaaattcttgtgaaagctgaataa

DBGET integrated database retrieval system