KEGG   Psychromonas ingrahamii: Ping_3307
Entry
Ping_3307         CDS       T00450                                 

Name
(GenBank) formate acetyltransferase
  KO
K00656  formate C-acetyltransferase [EC:2.3.1.54]
Organism
pin  Psychromonas ingrahamii
Pathway
pin00620  Pyruvate metabolism
pin00640  Propanoate metabolism
pin00650  Butanoate metabolism
pin01100  Metabolic pathways
pin01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:pin00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    Ping_3307
   00640 Propanoate metabolism
    Ping_3307
   00650 Butanoate metabolism
    Ping_3307
Enzymes [BR:pin01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.54  formate C-acetyltransferase
     Ping_3307
SSDB
Motif
Pfam: PFL-like Gly_radical
Other DBs
NCBI-ProteinID: ABM04994
UniProt: A1SZS9
Position
4077834..4080119
AA seq 761 aa
MTKINEELASAWQGFAGEVWKTDVNVRDFIQKNYTPFEGDESFLAGATQATDALWAKVME
GIKLENSTHAPVDFDTDIVSTITAHDAGYINQDLETIVGLQTDAPLKRAIIPNGGIRMID
GSCKVYGKELDPTINKIYSEFRKTHNQGVFDVYTGDILKCRKSGILTGLPDAYGRGRIIG
DYRRVALYGIDFLMTDKAEQHKSLEKDLLAGATLEDTLKLREEIFEQYRALAQIKEMAAK
YGSDISRPAQNAKEAIQWTYFGYLAAIKSQNGAAMSFGRTMSFLDIYIEKDMQAGVLTET
EAQELIDHLVMKLRMVRFLRTPEYDDLFSGDPIWATESIGGMGVDGRTLVTKSSFRILHT
QYTMGPSPEPNITVLWSEALPVNFKKYCAKVSIDTSSIQYENDDLMRSNFDNDDYAIACC
VSPMIVGKQMQFFGARANLAKTLLYAINGGVDEKSKVQVGPSTLPAITSEVLDYDEVFAN
LDHFMEWLAETYVTALNCIHYMHDKYSYEASLMALHDRDVERTMACGIAGLSIAADSLSA
IKYATVKPVRDEDGIATDFEIEGDYPKFGNNDPRVDDMACDLVERFMKKIQSHKMYRNAR
ATQSILTITSNVVYGKKTGNTPDGRRSGMPFAPGANPMHGRDEKGAVASLTSVSKLPFSY
AQDGISYTFSIVPNALGKTDDSQKTNLAGLMDGYFKHTPEIEGGQHLNVNVMNREMLVDA
MDNPEKYPQLTIRVSGYAVRFNSLTKEQQSDVISRTFTARL
NT seq 2286 nt   +upstreamnt  +downstreamnt
atgactaagattaatgaagaattggcatcagcatggcaaggttttgctggtgaagtttgg
aaaactgacgttaacgtacgtgacttcatccaaaaaaactataccccctttgaaggtgat
gaaagtttcctggcgggtgcaacccaagccactgatgcgctttgggctaaggtgatggaa
ggcatcaaactggaaaacagcacccatgcgccagttgatttcgatactgatattgtttct
accattaccgctcatgacgcaggttatatcaaccaagatttagaaaccattgttggtctg
caaaccgatgcgcctttaaaacgtgcgattatccctaacggcggtattcgtatgatcgat
ggttcttgtaaagtttatggtaaagagctcgatccaactattaataaaatttactctgaa
ttccgtaaaacacataatcagggtgtttttgatgtttacacaggtgacatcctaaaatgt
cgtaaatcaggtatcttaaccggtttgcccgatgcttatggtcgtggtcgtattatcggt
gattaccgtcgtgttgccctgtacggaattgacttcctaatgaccgataaagcggagcag
cataaaagcttagaaaaagatttacttgccggagcaacacttgaagataccctgaaatta
cgtgaagagatctttgagcaataccgtgcactagcacaaattaaagagatggcggctaaa
tacggctcggatatctctcgtcctgcacaaaatgcgaaagaagccattcaatggacttac
tttggttatctggcggcaatcaaatcacaaaatggcgcagcaatgtcatttggtcgtact
atgagtttccttgatatctatattgaaaaagatatgcaggcaggtgtacttaccgagact
gaagcacaagagcttatcgatcacttggtcatgaaattacgtatggtacgtttcctacgt
acacctgaatacgatgatctgttctccggcgaccctatctgggcaacggagtctattggc
ggcatgggcgttgacgggcgtacgctagtgactaaaagcagcttccgtattctgcataca
caatacactatgggcccttctccagagccgaacattactgttttatggtctgaagcatta
cctgttaactttaaaaaatactgtgcaaaagtatcgattgatacttcctctattcagtat
gaaaatgatgacttgatgcgcagcaattttgataacgatgattacgctatcgcctgttgt
gtatcccctatgattgtcggtaagcagatgcagttctttggtgcgcgtgccaaccttgct
aaaaccttgctttacgccattaacggcggcgtagatgaaaaatctaaagtgcaggttggt
cctagtacattgcctgcaattacctctgaagtcttagattatgatgaagtatttgcgaac
cttgaccactttatggaatggttagctgaaacctacgtcactgcacttaactgtattcat
tatatgcatgacaaatacagttatgaagcatcgctaatggcactgcacgatcgtgatgtt
gaacgtactatggcttgtggtattgccggtctttcaattgcagctgattcactttctgcc
ataaaatacgcaaccgttaaacctgtccgtgatgaagacggtattgcaactgattttgag
atcgaaggtgattaccctaaatttggtaacaatgacccgcgtgtagatgacatggcttgt
gatcttgttgaacgttttatgaaaaaaattcaatcgcacaaaatgtaccgcaatgcacgt
gcgactcaatctatccttactattacttctaacgtggtatacggtaaaaaaaccggtaac
acacctgatggacgtcgttctggcatgccctttgcgcctggtgctaaccccatgcatggt
cgtgatgaaaagggtgcggttgcatcattaacctctgtttctaaactgccattttcctac
gcacaggatggtatttcatatactttctcgattgtaccaaatgcattaggtaaaactgac
gattcacaaaaaacaaacttagcgggtctgatggacggttactttaagcacacccctgag
attgaaggtggtcagcacttaaacgtaaacgtgatgaaccgtgaaatgctggttgatgca
atggataatcctgaaaaatacccgcagttgactatccgtgtttctggttatgcagtacgt
tttaactcgttaactaaagaacagcaaagcgatgtgatttcacgtacctttactgccagg
ttgtaa

DBGET integrated database retrieval system