KEGG   Psychromonas ingrahamii: Ping_0005
Entry
Ping_0005         CDS       T00450                                 

Gene name
ftsN
Definition
(GenBank) cell division protein FtsN
  KO
K03591  cell division protein FtsN
Organism
pin  Psychromonas ingrahamii
Brite
KEGG Orthology (KO) [BR:pin00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:pin03036]
    Ping_0005 (ftsN)
Chromosome and associated proteins [BR:pin03036]
 Prokaryotic type
  Chromosome partitioning proteins
   Divisome proteins
    Ping_0005 (ftsN)
SSDB
Motif
Pfam: SPOR MMM1 ISK_Channel
Other DBs
NCBI-ProteinID: ABM01880
UniProt: A1SQW5
Position
complement(10064..10597)
AA seq 177 aa
MATENRRKPATPKKAVVRKRTAVKKTASKKGIPYLAISAVVLIIGFIGFFMFGVEKPSAP
QRVNKPVQKKEDVLPEKPQPIWEYEKTLKTKKITVDIPEKEAQTRPYQMQCASFRARGDA
ESLKAKIAFQGLNSEVLKTGDWYRVILGPYERKRLAEKHRHKLQRAKINGCQIWFWR
NT seq 534 nt   +upstreamnt  +downstreamnt
atggcaaccgaaaacagacgaaaaccggctactccaaaaaaagccgtcgtgcgtaaacgc
acggcggtaaaaaaaacagcatctaaaaaagggattccctacttagctatttctgctgtt
gtattgatcatcggatttattggtttttttatgtttggggttgaaaaaccgtccgcgcca
caaagagtgaataaacctgttcagaaaaaagaggacgttttaccagaaaaacctcaacct
atctgggaatatgaaaaaacacttaaaaccaagaaaataaccgttgatatacctgaaaag
gaagcacaaacaagaccttatcaaatgcagtgtgcttcatttcgtgcacgaggtgatgca
gaatcactcaaagctaaaattgcatttcagggtttaaatagcgaagtattaaaaacaggt
gattggtaccgggttattttagggccctatgaacgtaaaagactggcagaaaaacaccgt
cataaactacagcgagctaaaattaatggttgccaaatttggttctggcgttaa

DBGET integrated database retrieval system