KEGG   Psychromonas ingrahamii: Ping_0011
Entry
Ping_0011         CDS       T00450                                 

Definition
(GenBank) Uncharacterized conserved protein UCP028301
  KO
K11901  type VI secretion system protein ImpB
Organism
pin  Psychromonas ingrahamii
Brite
KEGG Orthology (KO) [BR:pin00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:pin02044]
    Ping_0011
Secretion system [BR:pin02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   Ping_0011
SSDB
Motif
Pfam: T6SS_VipA
Other DBs
NCBI-ProteinID: ABM01886
UniProt: A1SQX1
Position
17602..18108
AA seq 168 aa
MSMKDKRSGSVAPKERINISYKPAVGNAKEAVELPFKLLVLGDFTQSQIVTSLEDRKLIN
INKYNFSDVMDSFDLKVQFSVENKINKGSDEPIDISLSIKQLSDFEPDSIIQQVDELKKV
LELREALKALKGPIGNSPQMRKQIRNLLIDEKSRNELKLELGLSANKQ
NT seq 507 nt   +upstreamnt  +downstreamnt
atgtctatgaaagacaagcgctcaggttcagttgcacctaaagagcgtattaatatatct
tataaaccagcggtaggtaacgctaaagaagccgttgaactcccttttaaactgctagtc
ttaggagatttcacccaaagtcaaatagttacttctctggaagatagaaagttaattaat
ataaataaatataatttctccgatgtaatggatagctttgaccttaaagttcaatttagt
gtagaaaataaaatcaataaaggaagtgatgagccaattgatatatctctaagtataaaa
cagttaagtgactttgaaccagatagtattatccaacaagttgatgaattgaaaaaagtt
cttgagcttcgagaggcattaaaagcactgaaaggcccaatcggtaattcccctcaaatg
cgtaaacaaatacgcaaccttttaattgatgaaaaatcacgaaatgaattaaaacttgag
ctgggtttatctgctaataaacaataa

DBGET integrated database retrieval system