KEGG   Psychromonas ingrahamii: Ping_0013
Entry
Ping_0013         CDS       T00450                                 

Definition
(GenBank) secreted protein Hcp, potential oxidative stress protein
  KO
K11903  type VI secretion system secreted protein Hcp
Organism
pin  Psychromonas ingrahamii
Pathway
pin03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:pin00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    Ping_0013
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:pin02044]
    Ping_0013
Secretion system [BR:pin02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   Ping_0013
SSDB
Motif
Pfam: T6SS_HCP
Other DBs
NCBI-ProteinID: ABM01888
UniProt: A1SQX3
Position
19699..20217
AA seq 172 aa
MPTEIYMSINDPEGCLTEESCSKESIGSFFKADHEEESLILAYDHKVSVPTNSLTGQVTG
TRKHEYLEVSKFIDKSSPLLLNTVTSPSELEVILRFFRTPDETSAGEPVEYYNITLQRAK
IVSINTISPNILDEVNDGLMPYEKVRFTYGQIQADHVVCGTTAIDDWSGEGG
NT seq 519 nt   +upstreamnt  +downstreamnt
atgcctactgaaatttatatgtccattaatgaccctgaagggtgtttaacagaagaatct
tgttcaaaagaaagtataggttcattctttaaggccgatcatgaagaagagtcattaatt
ctagcttacgatcataaagtaagtgtgccaactaattcattaacgggacaggtgacaggg
acaaggaaacatgaatatctggaggtcagtaaatttatagataaaagctcccccttattg
cttaatactgtgacctccccatcggaactggaagtcattttgaggttctttagaaccccg
gatgaaaccagtgcaggtgaacctgtagagtattacaacatcactttgcagcgcgctaaa
attgtgagtattaatacaatatcacctaatattttagatgaagtaaatgacggtttaatg
ccctatgaaaaggtcaggtttacttatgggcaaattcaagcggatcatgtggtttgtgga
acaactgcgattgatgattggtctggggaaggcggttag

DBGET integrated database retrieval system