KEGG   Psychromonas ingrahamii: Ping_0014
Entry
Ping_0014         CDS       T00450                                 

Definition
(GenBank) hypothetical protein
Organism
pin  Psychromonas ingrahamii
SSDB
Motif
Pfam: T6SS-SciN Peptidase_M9_N
Other DBs
NCBI-ProteinID: ABM01889
UniProt: A1SQX4
Position
20228..20935
AA seq 235 aa
MKNFIYNSTIWIRITCISILLSGCSLLPNSQVEVQKKDNIDYWSDSSGSWENWDENHPSN
ELVAWTYDKDGIQVNFVARPELNIFGQRSHTLVVKIVQLSEVSGINTLFQTNEGIAAALT
QETEMIPNAIFSESFVLGPKQNLMFRLARQENAKYIAIIAGFAELDRRQAVRIIPISVNT
TLQEPIDAEWTTLDKMTFGYFVSKEPQPDILRPSNIRLNIDFGENSITKFSATAE
NT seq 708 nt   +upstreamnt  +downstreamnt
atgaaaaatttcatttataactcaacaatatggatacgcatcacttgcatatctatattg
ctgagcggttgtagtctattgcctaatagtcaggtggaagtacagaaaaaagataatatt
gattattggtctgatagctcagggtcttgggaaaactgggatgaaaaccaccccagtaat
gaacttgttgcttggacatatgataaagatggcattcaagtcaatttcgttgcccgtcca
gaattaaatatatttggacaacggtcccacactttagtcgtcaaaattgttcagttatca
gaagtctcaggtatcaatacgctttttcagaccaacgaagggattgccgctgcgttaacg
caagaaactgaaatgatacctaatgccatatttagtgaatcatttgttttggggccaaag
caaaaccttatgttcaggctagcccgccaagaaaatgccaagtatatcgctattattgca
ggttttgctgagctagataggcggcaagcggtacgcattattcctatttctgttaatact
acgttacaagagccgatcgatgccgagtggactactttggacaagatgacctttggctat
tttgtaagtaaagagcctcaacccgatattttaagaccctcaaatattaggcttaatatt
gactttggtgaaaacagtattacaaagttcagcgcgacagctgaataa

DBGET integrated database retrieval system