KEGG   Psychromonas ingrahamii: Ping_0015
Entry
Ping_0015         CDS       T00450                                 

Definition
(GenBank) hypothetical protein DUF876
  KO
K11893  type VI secretion system protein ImpJ
Organism
pin  Psychromonas ingrahamii
Brite
KEGG Orthology (KO) [BR:pin00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:pin02044]
    Ping_0015
Secretion system [BR:pin02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   Ping_0015
SSDB
Motif
Pfam: T6SS_VasE DUF4495
Other DBs
NCBI-ProteinID: ABM01890
UniProt: A1SQX5
Position
20951..22315
AA seq 454 aa
MDSMKSIYWNQGLFLKPQHFQQLDRYTSTMSNLYSKVRSGVESGISELKFDLSALKTGLL
VIEKLECILEDGSLLLYPGNCQIPPLRLDKEQFDDSGNLNIFIALAPISAEQNNLVSNSS
PDARFKLAADINKKDLFDNNEQATLSMLDFNCNLVPSYNLKSTAGLSLLKVAEIFLSVDQ
CTPSETFIPKITLLSGSEVLKNLVKSTKQSLVGRFEQLQNITSFESGLVNSSNNLSVGLA
MMSISNHIATFIQFEENPSTQVSDIYLAYRQLISQLSMFSTEVSVIGETLTEENSIIPFN
QNNLSDCFSKVNNLTTKLLNELTVQPELLVNLIYQGDSKFVAQLSREFLDPGYRIYLRIR
TKENVIDHLDNILNFLKVGADGQVDVYLKRALPGVQLSYLDKKPQGVATVPNSYYFGLDR
QSFQWQKVIELSRIGVIWSDYIEDVALDLIAVQG
NT seq 1365 nt   +upstreamnt  +downstreamnt
atggattcaatgaagtcgatatattggaatcaggggctatttttaaaacctcagcatttt
caacagttagatagatatacatccactatgtctaatctatattctaaagttcgtagcggc
gtagaatcaggtatttcagaattaaaatttgatctttctgctttgaaaacaggtttatta
gtcattgaaaagttggaatgtatattagaagacggcagtttacttttatacccgggaaac
tgtcaaattccaccattaaggttagacaaagagcagtttgatgacagtgggaatctgaat
atatttattgctttagcacccatttctgcagagcaaaataatttagtttcaaattcatca
cccgatgctcgctttaagcttgccgctgatatcaataaaaaagatctatttgataataat
gaacaagcaacgttatcgatgttagattttaattgtaatttagttccaagctataatttg
aaaagtactgcgggtttatctcttcttaaagtagctgaaatatttttatcggttgatcaa
tgcacaccttcagaaacttttattcctaagataacgttattaagcggttctgaagtactt
aagaatttagtcaaatcaactaaacaaagtttagtcgggcgatttgaacaacttcaaaat
ataacctcttttgaatcaggacttgtaaatagctcaaataatttatctgtcggtttagcg
atgatgtcaattagtaatcatattgccacatttatccagtttgaagaaaatccatcaaca
caagtctctgatatttatctggcttatcgacaattaatctcacaattgagcatgttttcg
acagaagtttcagttattggtgaaacccttactgaagaaaattctattatcccgtttaat
caaaataatttaagcgattgtttttctaaagtaaataatctgacaactaaattattaaac
gagttgaccgttcagcctgaattattagttaatttaatttatcagggtgattcaaaattt
gtagcccaattatcgcgtgaatttttagatcccggttaccggatttatctaagaattaga
accaaagaaaatgtcattgatcatttagataatattcttaattttctaaaagttggggcc
gatggacaagttgatgtttacttgaaaagagcacttccgggagttcaattgtcgtattta
gataaaaaaccccaaggagttgcgactgtcccgaatagctattattttggtcttgatagg
cagtccttccaatggcagaaagtcattgagttaagccgaattggtgttatttggagtgat
tatatagaagacgttgctctcgatttgatcgctgttcaaggataa

DBGET integrated database retrieval system