KEGG   Psychromonas ingrahamii: Ping_0017Help
Entry
Ping_0017         CDS       T00450                                 

Definition
(GenBank) conserved hypothetical protein
  KO
K11891  type VI secretion system protein ImpL
Organism
pin  Psychromonas ingrahamii
Pathway
pin03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:pin00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    Ping_0017
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:pin02044]
    Ping_0017
Secretion system [BR:pin02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   Ping_0017
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ImcF-related_N IcmF_C
Motif
Other DBs
NCBI-ProteinID: ABM01892
UniProt: A1SQX7
Position
22981..26403
Genome map
AA seq 1140 aa AA seqDB search
MKKFLKFLLVVFIWLVIFGVCVAGSLLLGATEVEGIQVFLAIFIAWYAIKFCIYLYKRWQ
AKQRVEKLINIDASTKEKTKLSFFQFLFPKSIDKHIKRVLKRINHNVSSDENQQEADFIM
HIKMDNKHADWLYTETVNRPQIADPIFSEYKYLQWIVLNDLVILDVDSYLIKNADSAANS
EWLQLLNGLASSEKSKSLDGLLISIHVADLVDPATRSQIADQLRKKYEEIKEYCGVEVPV
NISLLGLEERKGVDDWLGQLSNDWKKQTLGVINQQKEPVKNIIQSCFSKIQAIFKQGSLD
YIVNQGFDETVANLPHKIKDIQDSVELFCSRLFSSNSFQGKPVCSGLFLVMAEKNKAVFV
DDLLEQSALCWLPAISMNKNTASDIEKNKRLWTYLSATTVLVILLGTLYNSDKNNIEQIY
QDYESQLSKSEDQVKVRDNLESRYQLITKLNDVNISYWLPLSESVFNIPTLKAELANDIQ
DVLISPVDKYFEDNIKQLSNKNIDSKVDYLNILMRRINVLSAASKGASLTDLAELPQPFD
SAYIDNMSPDMIDGLNSLYIKSLFMIKDANDASYLKNWQQQITKYRNDISTLLLSSNGTM
DWLIDWVNHNGKVDSVQLSDYWQGSRHIQSPILIEGAYTLAGKTIIDDFSEQILYALGEE
HPFLLKFLPVFQQQYQHNYVAKWGAFLKNFHTGTATLSSRSEWLNVINNLTTGRNIFFKL
LNDADYQLAPFNDLEDKPDWFDFSLYYQDMLALGEDEAQSNPAKNKVFTKLALKVVGSLG
PVGKAISGSGKKALKTKKKLDKASGSGPGPSERALNLQEAGKGLDEYKGLIADLVFNIEQ
QKESHKSIRAFFEFENNPIDEGTVLANAKLNIMNLQGLIGKAGNSTASFWNVYIGSILVL
ENFMLEESACLLEKSWEEDFLYELEGVPAYKLDEFAYGESGVLWSFFDKTLQPFIQNKRG
GGYSFKKVVEKKIPLSPDLLDYLIRAKDLKTRQKFKSFDLFMTAKPTDTNANSLLYVSET
DISLICEAETQTLVNKNYIVNKLFKWDETCRSVSLKLKVGNKILEKVYSGDDGVFNFLDD
FKSGVKRFELEEFPVYFYELNSYRIEYFDVKLNIKGADRLRQALSIKPPQPPESIAQCWM
NT seq 3423 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaattccttaagtttttactcgtcgttttcatttggttagtcatatttggtgtt
tgtgtggctggatctttattgttaggtgccactgaagttgaaggtatacaagttttcttg
gctattttcatcgcctggtatgctattaagttttgcatctacctttataagcgctggcaa
gcaaaacaacgagttgaaaaattaattaatattgatgcgtcaacaaaggagaaaacaaaa
ttatcattttttcaattcttatttcctaaatccattgataagcatattaaacgcgtccta
aagagaattaaccacaacgtcagtagcgatgaaaatcagcaggaagctgattttattatg
catattaaaatggataataaacatgctgactggttatacactgaaacagtcaatagacct
caaatagccgatccaattttcagtgaatataaatatcttcaatggattgtgctaaatgat
cttgtgattctagatgttgactcttatttaattaaaaatgctgattctgccgctaacagt
gaatggctgcaattactcaatggcttagcatcaagcgaaaaatcaaaatccttagacgga
ttattaatatcgattcatgttgctgatttagttgatcctgcaacgagaagccagattgca
gatcaacttcgaaaaaaatatgaagaaattaaagagtattgtggtgtagaagttcctgtg
aatatttcacttcttggattagaagagcgaaaaggagttgatgactggctaggacaactg
agtaatgattggaaaaagcaaaccttaggcgttattaaccaacaaaaagagccggtgaaa
aatattatccaaagctgtttttcgaaaattcaagctatttttaaacaaggatctttagat
tatattgttaatcaagggttcgatgaaaccgttgccaatctgcctcataaaatcaaagat
attcaagactctgtcgagttattctgctcgcgtttattttcaagcaatagttttcaaggc
aaacctgtttgttcaggtctgtttcttgttatggcagaaaagaacaaagctgtatttgtt
gatgatctgttagagcaatcagctttatgttggttgcctgctatatcaatgaataaaaat
actgccagtgatattgaaaaaaacaaacggttatggacttatttatctgcaacaacagtg
ctagttattctgttggggactttgtataactccgataaaaataatattgagcaaatatat
caagattacgaatcgcaactttcaaagtctgaagatcaagtcaaagttagggacaatctt
gagagtagatatcaattaattaccaaactaaatgacgttaatataagttattggctaccc
ctttcagagagtgtttttaatatacctacattaaaagctgaactggctaatgatattcag
gatgttttaatttctccggtcgataagtactttgaagataatattaaacaattatcgaat
aagaatattgatagtaaagttgattatttaaacatattaatgcgcagaataaatgtgcta
agtgcagcaagtaaaggggcttcattaacagatttagctgaattgcctcagccctttgac
agcgcgtatattgataacatgtcaccagatatgattgatggattaaacagtttatatatt
aaaagcttgtttatgataaaggatgcaaatgacgcaagctatctcaaaaactggcagcag
caaataacaaaatatcgtaatgatatttctaccttattattatcttctaatggaacaatg
gactggttaattgactgggttaatcataatggaaaagttgattcggtacagctgagtgac
tactggcaaggttctaggcatatccaatcacctatcttaattgaaggtgcctatacgtta
gcaggtaaaacaattattgatgatttttcagagcaaattttatatgctctaggagaggaa
cacccgtttttgttaaaatttttacctgtatttcaacagcaatatcagcataattatgtc
gcaaaatggggggctttcttaaaaaatttccatacaggaacggcaacattgagtagccga
tcagaatggttaaatgttattaataatttgaccaccggacgaaatatttttttcaagtta
ttaaatgatgcggattaccaattagctccttttaatgatttagaggataagcccgattgg
tttgatttttccctttattaccaagatatgctggccctaggtgaagatgaagcccaatct
aaccctgcaaagaacaaagtatttaccaagttagcgttaaaggtggtgggatcattaggt
cctgttggtaaggctatttcaggttctgggaaaaaggcgttgaaaaccaagaaaaaattg
gataaagccagtggttctggtccaggcccttcagaaagagcgttaaatttacaagaagcc
ggcaaaggcttggatgaatataaagggctgattgcggatttagtgttcaatattgaacag
caaaaagagtcgcacaaaagcattcgcgcattttttgagtttgaaaataacccgatagac
gaaggcactgttttagcaaatgcgaaacttaacatcatgaacctgcaggggttaataggt
aaagcgggtaattccacggcatcattttggaatgtgtacattggatctattttagtgcta
gaaaactttatgcttgaagaaagtgcatgtttgcttgaaaaatcatgggaagaagatttt
ctctatgaattagaaggggtaccggcctataagctagatgagtttgcttatggggaatca
ggtgttttatggtcattttttgataaaaccttacaaccttttattcaaaataagcgcgga
gggggttatagtttcaaaaaagtggtggagaaaaaaattcctttgtcaccggatttatta
gattacttaattcgagctaaagacttaaaaacacgtcagaagtttaaatcctttgattta
tttatgacggcaaaaccaacagatacaaatgcaaactcactattatatgtatcagaaacc
gatatcagcctgatttgtgaagcagaaacacaaacactggtaaataagaattatatcgtc
aataagctttttaaatgggatgaaacatgtcgttctgttagtttaaagctaaaagtgggt
aacaagatacttgagaaagtttacagtggtgatgacggtgtattcaatttcttggatgat
tttaaatctggtgttaaacgctttgaattggaagagtttcccgtatatttttatgaatta
aacagttatcgaattgaatactttgacgttaaattaaatatcaaaggtgccgataggtta
agacaagcgttatctatcaaaccaccacaaccgcctgaatcaatcgcgcaatgttggatg
taa

DBGET integrated database retrieval system