KEGG   Psychromonas ingrahamii: Ping_0019
Entry
Ping_0019         CDS       T00450                                 

Definition
(GenBank) hypothetical protein DUF796
  KO
K11903  type VI secretion system secreted protein Hcp
Organism
pin  Psychromonas ingrahamii
Pathway
pin03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:pin00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    Ping_0019
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:pin02044]
    Ping_0019
Secretion system [BR:pin02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   Ping_0019
SSDB
Motif
Pfam: T6SS_HCP Transglut_i_TM
Other DBs
NCBI-ProteinID: ABM01894
UniProt: A1SQX9
Position
28101..28589
AA seq 162 aa
MEFSGYMKIEGDIQGVIEGSSIRKNRETSIDLFSFKHEIKLPTNVQSGMGNGPVIHQPIV
LLKEVDKSTPKLYRALVEKERLNTVEFEWFRYTAQGEELVYYRIELINAHIISISPWTPA
LEKAESEYLRFMENVTLAYEGITWSWGPDGDVTYQTNWRGEQ
NT seq 489 nt   +upstreamnt  +downstreamnt
atggaattttcgggttatatgaaaattgaaggtgatattcagggcgttattgaaggctct
tcaattagaaaaaatcgagaaacgagtattgatcttttttcatttaaacatgaaattaaa
ttacccactaatgtgcagtcaggtatgggaaatggtccggttattcatcagccaattgtc
ttattaaaagaggttgataaaagtaccccaaagctatatcgcgcattggttgaaaaagaa
cgattaaatacagttgaattcgaatggtttcgatatacggcgcaaggtgaagagcttgtt
tattatcgtattgaattaataaatgcgcatattatatcaatctctccctggacgcctgca
ttagaaaaagcggagtcagaatatttacgttttatggaaaatgtaacactggcctatgaa
ggtattacttggagttgggggccggatggtgatgttacttaccaaaccaattggcggggt
gagcaataa

DBGET integrated database retrieval system