KEGG   Psychromonas ingrahamii: Ping_0021
Entry
Ping_0021         CDS       T00450                                 

Definition
(GenBank) hypothetical protein DUF879
  KO
K11896  type VI secretion system protein ImpG
Organism
pin  Psychromonas ingrahamii
Brite
KEGG Orthology (KO) [BR:pin00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:pin02044]
    Ping_0021
Secretion system [BR:pin02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   Ping_0021
SSDB
Motif
Pfam: T6SS_TssF DUF5815 DUF416
Other DBs
NCBI-ProteinID: ABM01896
UniProt: A1SQY1
Position
28993..30762
AA seq 589 aa
MDLADLYQQELKLLKESSQVFSKEYPAITESLNRDIVDPDVDMILQGVSYLTAQFKKELD
DQFPVALQALSQVLTPTLMQPIPAVSILSLTPKANLISPLMVKKGTGFDSSPAKLDEEGH
ERIACRFSSAWEVEVLPVRVATLVMQQVEKTINQVQQKVVELNVGFTSEKNDLANYSFDK
LRFYINQPASDACIWLQMFAQKLQSIKVTSSAGVADISVKNLQLTGYGAEHNIFDAGNSS
NQHSLLQEYYTVPEKLQFFEINLQQWQQRSGDQFSIVFEFTSPTWSLPEFKTDHLKLYCT
PVINEFEHFAEPMAMNGIQLEFPLTAQQRNLSTEFVLPIVDVLTVESIKREREKNNRYQN
IIIPSNTNSKTGGFYYFRKHGVHDGDVANWLALEFEAGSRPESREVLRVKVKCCHGELAA
KLPPNEINVPTSSSPELVSFTNLTTSSDYLPAQIISNEAWQVVSDQALSLQNIEKADQLK
QLLRHHLPAQLKNTAKYKTLAHRIAAINDIKITAKDHFEKGLLVRGVEYSVHINSDHFIN
QGEIFLFSALLNQLLALQVPINSFSQLIVTESRTEESQRWAINFGGIAK
NT seq 1770 nt   +upstreamnt  +downstreamnt
atggatttagcagacctataccaacaagagttaaaacttttaaaagaatcatcacaggtt
tttagtaaagaataccctgcaattacagaaagtttaaatagagatatagttgaccccgat
gttgatatgatcttacagggtgtttcctatttaacggcgcaatttaaaaaagagttagac
gatcagtttccggttgcactgcaggccctatcacaagtattaacacccaccttaatgcag
cctattccggcagtcagcattctatcattaacgcctaaagcaaatttaatctcaccttta
atggttaaaaaagggactggatttgattcttctcctgcaaaactcgatgaagagggccat
gaacggatagcttgccgattcagcagcgcttgggaggttgaagtgttgccggtgcgtgtt
gcaacgttagtgatgcagcaggttgaaaaaacaattaaccaggtacaacagaaagtggtt
gaactcaatgtggggtttacatcagaaaaaaatgatctcgctaattatagctttgataaa
ctgcgtttttatattaatcaaccagcaagtgatgcttgtatttggttacagatgtttgct
caaaaattgcagtcaattaaagtgacaagctccgctggtgttgctgatatttcagtaaaa
aatttacaattaacaggctatggcgcagagcataatatttttgatgccggcaattcatca
aatcagcatagtcttttgcaggagtattatactgttcctgaaaaattacagttttttgaa
attaacctgcagcagtggcagcagcgtagtggtgatcaattttcaattgtttttgaattt
acctctcctacctggagcctgcctgaatttaaaaccgatcacctaaaactatactgtaca
ccggtgattaatgaatttgagcactttgctgagccaatggcgatgaatggtattcaactt
gaatttccattaaccgctcaacagcgtaatttatcgactgaattcgttttgcctattgtt
gatgttctgacggttgaaagtatcaagcgagaacgggaaaaaaataaccgttatcagaat
attataatccccagcaatacgaacagtaaaaccggtggtttttattattttagaaagcat
ggcgtgcatgacggggacgtagcaaattggttagctctggagtttgaagccggatcaaga
cctgaaagtcgagaagtgttacgtgtcaaagtcaaatgttgccatggtgagcttgctgct
aaattgcctcctaacgagattaatgtgccaaccagcagtagccctgaattagtttctttt
actaacctgacaaccagcagtgattatctgccggcgcagattatttccaatgaagcttgg
caggtggtatcagatcaggcattaagtttacaaaatatagaaaaagcggatcagcttaag
caacttctgcgtcatcaccttcctgcgcaacttaaaaacaccgcaaaatataaaaccctg
gcgcatcgaattgctgcgattaatgatattaaaataaccgcgaaagatcattttgaaaag
ggattattggttcgaggagtggagtattcagttcatataaacagtgatcattttattaac
cagggggaaatatttttattttcagccttgctgaatcagttattggcattacaagtgccc
attaatagtttcagtcaattaattgtgactgaatcccgtaccgaggaatctcaacgctgg
gcaattaattttggcggtatcgctaaatga

DBGET integrated database retrieval system