KEGG   Psychromonas ingrahamii: Ping_0335Help
Entry
Ping_0335         CDS       T00450                                 

Definition
(GenBank) ADP-glyceromanno-heptose 6-epimerase precursor
  KO
K03274  ADP-L-glycero-D-manno-heptose 6-epimerase [EC:5.1.3.20]
Organism
pin  Psychromonas ingrahamii
Pathway
pin00540  Lipopolysaccharide biosynthesis
pin01100  Metabolic pathways
Module
pin_M00064  ADP-L-glycero-D-manno-heptose biosynthesis
Brite
KEGG Orthology (KO) [BR:pin00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00540 Lipopolysaccharide biosynthesis
    Ping_0335
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01005 Lipopolysaccharide biosynthesis proteins [BR:pin01005]
    Ping_0335
Enzymes [BR:pin01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.20  ADP-glyceromanno-heptose 6-epimerase
     Ping_0335
Lipopolysaccharide biosynthesis proteins [BR:pin01005]
 Unusual sugar
  Ping_0335
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Epimerase GDP_Man_Dehyd 3Beta_HSD RmlD_sub_bind Polysacc_synt_2 KR Ldh_1_N
Motif
Other DBs
NCBI-ProteinID: ABM02201
UniProt: A1SRT6
Position
complement(435349..436284)
Genome map
AA seq 311 aa AA seqDB search
MFIVTGGAGFIGSSIVKSLNERGITDILVVDDLTDGAKFVNLVDLQIMDYMDKDEFITQI
VSGQDFGDIEAIFHEGACSATTEWNGKFMMENNYEYSKDLLHYCIERDIPFLYASSAATY
GGNDTFKEELKYEKPLNVYGYSKFQFDQYVRRIWEDAAAHDETLPQIVGFRYFNVYGPRE
QHKGSMASVAFHLNNQLNAGENAKLFEGEHKRDFVYIGDVCKVNLWFFDNNVSGIYNLGT
GQAESFLEVGQAVVAYHQKGEVERIPFPEHLKGRYQSFTEADLTNLRAAGYKDTFKSVAQ
GTAEYMAWLNR
NT seq 936 nt NT seq  +upstreamnt  +downstreamnt
atgtttatagttacaggtggtgcaggttttatcggcagcagtatagttaaatcccttaat
gaacgtggtatcaccgacattctggttgttgatgacctaactgacggtgccaaatttgtt
aatctggttgatttgcaaatcatggattatatggataaagatgaattcatcacccaaatt
gtctccggtcaggattttggtgatattgaagcgattttccatgaaggtgcctgctcggca
accactgaatggaacggcaaattcatgatggaaaataattatgaatattctaaagatctg
ctgcattactgtattgagcgtgatattccatttttatacgcttcatctgcggcaacctat
ggcggtaacgatacttttaaagaagaattaaaatatgaaaagccattaaatgtttacggc
tactctaaattccagtttgaccagtatgtgcgacgtatctgggaagatgctgcagcccat
gatgaaacactgccgcaaattgtaggttttcgttattttaatgtctacggcccacgcgaa
cagcataaaggcagtatggcaagtgttgccttccatttaaataaccagcttaatgccggt
gaaaatgctaaattatttgaaggtgaacataaacgtgatttcgtttatattggagatgtc
tgcaaagtaaatctatggttttttgataataatgtttcaggtatttataatctgggcaca
gggcaagcagaatctttccttgaagtaggtcaagccgttgttgcttatcaccagaagggc
gaagttgaacgcatcccttttcctgaacatttaaaaggtcgctaccagagtttcaccgaa
gctgatttaacaaatttgcgggcagcgggttataaagatactttcaaatctgttgcacaa
ggtactgctgaatatatggcttggctaaacagataa

DBGET integrated database retrieval system