KEGG   Psychromonas ingrahamii: Ping_0659Help
Entry
Ping_0659         CDS       T00450                                 

Definition
(GenBank) beta-ketoadipyl CoA thiolase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
pin  Psychromonas ingrahamii
Pathway
pin00071  Fatty acid degradation
pin00280  Valine, leucine and isoleucine degradation
pin00310  Lysine degradation
pin00362  Benzoate degradation
pin00380  Tryptophan metabolism
pin00620  Pyruvate metabolism
pin00630  Glyoxylate and dicarboxylate metabolism
pin00640  Propanoate metabolism
pin00650  Butanoate metabolism
pin00900  Terpenoid backbone biosynthesis
pin01100  Metabolic pathways
pin01110  Biosynthesis of secondary metabolites
pin01120  Microbial metabolism in diverse environments
pin01130  Biosynthesis of antibiotics
pin01200  Carbon metabolism
pin01212  Fatty acid metabolism
pin02020  Two-component system
Brite
KEGG Orthology (KO) [BR:pin00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    Ping_0659
   00630 Glyoxylate and dicarboxylate metabolism
    Ping_0659
   00640 Propanoate metabolism
    Ping_0659
   00650 Butanoate metabolism
    Ping_0659
  09103 Lipid metabolism
   00071 Fatty acid degradation
    Ping_0659
   00072 Synthesis and degradation of ketone bodies
    Ping_0659
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    Ping_0659
   00310 Lysine degradation
    Ping_0659
   00380 Tryptophan metabolism
    Ping_0659
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    Ping_0659
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    Ping_0659
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    Ping_0659
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:pin04147]
    Ping_0659
Enzymes [BR:pin01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     Ping_0659
Exosome [BR:pin04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Ping_0659
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt DUF348
Motif
Other DBs
NCBI-ProteinID: ABM02512
UniProt: A1SSP7
Position
844194..845399
Genome map
AA seq 401 aa AA seqDB search
MINAYICDAIRTPIGRYGGGLSPIRPDDLGALPIKAIMERNPDIDWREIDDVIYGCANQA
GEDNRNVARMSLLLAGLPEEVSGTTINRLCGSGMDAISLVARSIKAGDAELMIAGGVESM
SRAPFVMGKATSAYSRNAEMYDTTIGWRFINKELQKQFGTDSMPETAENVAARYNISRED
QDAFALRSQYRTEQAQKSGRLSEEIVPVTILNRKSEPTIIDKDEHPRPETTLSQLANLRT
PFAENGSVTAGNSSGVNDGAAAMLIASDKAVIKYGLLPKAKVIACATAGVEPSIMGMGPA
PAVKKVLKKAGLSIDDMDVIELNEAFAAQSLAVLRELGLPDDADHVNPNGGAIALGHPLG
MSGTRLVMAATNELTRRKGKYALCCMCIGVGQGIAMIIERV
NT seq 1206 nt NT seq  +upstreamnt  +downstreamnt
atgattaatgcatatatctgcgatgcaataagaacaccaataggtcgttacggcggcggt
ctctcaccaatacgtccggatgatctgggcgctttacccattaaagccattatggaacgt
aatccggatattgattggcgagaaattgatgatgttatttatgggtgtgcaaaccaggct
ggagaagataatcgtaatgttgcgcgcatgagtctgctgcttgccggattgccggaagaa
gtatcaggtaccactattaatcgcttatgtggctctggtatggatgctatttcacttgtt
gcaagaagtattaaggcaggtgatgcagagcttatgattgctggtggtgttgaatcaatg
tcacgcgctccttttgtgatgggtaaagcgacgtcagcttactcccgcaatgcagaaatg
tacgatacaaccattggatggcgctttataaataaagagctgcaaaaacagtttggcacg
gactctatgcctgaaacagcagaaaatgtcgctgcccgatacaatatctcccgcgaagat
caggatgcttttgccctaagaagtcaataccgcactgaacaagcccagaaatcgggaaga
ctgtcagaagaaattgtgccggtgaccattttaaatcgcaaatctgaaccaaccattatt
gataaagatgagcacccgcgtccagaaacaacgctttctcaattagctaatttacgtact
ccttttgctgaaaatggcagtgtgactgctggcaattcgtctggtgttaatgatggtgct
gctgcaatgttaatcgcaagcgacaaagcggttattaaatacggtttattaccaaaagca
aaagtgattgcctgtgcaactgccggggttgagccatccataatgggaatgggtccagca
cctgcggttaaaaaagtgcttaaaaaagcgggtttatcaattgatgatatggatgtaatt
gaattaaatgaagcttttgcagcacaatcattagccgtattacgtgaattagggttgcct
gatgatgctgatcatgtcaacccaaatggcggtgccattgcattagggcatccactggga
atgagcggtactcgacttgttatggctgccactaatgagttaacacgacgtaaaggaaaa
tatgcgctttgttgcatgtgtatcggtgttggtcaaggcattgccatgatcattgaacgc
gtttaa

DBGET integrated database retrieval system