KEGG   Psychromonas ingrahamii: Ping_0912Help
Entry
Ping_0912         CDS       T00450                                 

Definition
(GenBank) 4-diphosphocytidyl-2-C-methyl-D-erythritol kinase
  KO
K00919  4-diphosphocytidyl-2-C-methyl-D-erythritol kinase [EC:2.7.1.148]
Organism
pin  Psychromonas ingrahamii
Pathway
pin00900  Terpenoid backbone biosynthesis
pin01100  Metabolic pathways
pin01110  Biosynthesis of secondary metabolites
pin01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:pin00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    Ping_0912
Enzymes [BR:pin01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.148  4-(cytidine 5'-diphospho)-2-C-methyl-D-erythritol kinase
     Ping_0912
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GHMP_kinases_N GHMP_kinases_C
Motif
Other DBs
NCBI-ProteinID: ABM02754
UniProt: A1STD9
Position
complement(1141705..1142559)
Genome map
AA seq 284 aa AA seqDB search
MIHNETIRWPAPAKLNLFLYITGQREDGYHELQTLFQFIDLCDYLTITPNLSGKITLTPN
IEGLALENNLIYKAAMILKTHTAANNGAHITLEKNLPMGGGLGGGSSDAATTLVALNHQW
NINLTKDKLAEIGVLLGADVPVFIFGKAAIAEGIGEKLTPAYPAERSYLIAVPDCHISTA
AVFQAKNLIRNTKKRTHLQLINQNWLNDCQPYVKKNYPKVAKVIEWLIEYAPTQLTGTGA
CVFSTFNSINEAEIVLHNTPDWLAALTAKGLNNSPLNELLATLK
NT seq 855 nt NT seq  +upstreamnt  +downstreamnt
atgatacataatgaaactattcgttggcctgctcctgctaaactgaacttattcttatat
ataacgggccaacgggaagatggttaccatgaattacaaaccctattccaatttatcgat
ctatgtgattatttaactatcacgcctaatctctctggaaaaataacgcttacgccaaac
atcgaagggttggcattagaaaataacctaatctataaagcggcgatgatattaaaaacc
catacggcagcaaataatggggcacatattactctggaaaagaatttaccgatgggcgga
ggcttaggtggaggttcatccgatgcagcaacaacactggttgcattaaatcatcaatgg
aacatcaatttaacaaaagataaattggcagaaataggcgttttattgggcgcggacgta
cctgtttttatctttggcaaagccgcgatagcagaaggtataggtgaaaaattaaccccg
gcttaccccgcagagcggagttatctgattgctgtacccgattgccatatttcaacagcc
gccgtttttcaggcaaaaaatctcattcgcaataccaaaaaaagaacccatttacagtta
ataaatcaaaattggctgaacgactgccagccctatgtgaaaaaaaattatcctaaggtt
gccaaggttatagagtggttgatagaatatgcgccaactcaattgactggcactggtgca
tgtgtttttagcacatttaacagtattaatgaagctgaaattgtgttacataatactcct
gactggttagcagcattgaccgcaaaaggattaaataattcgccattaaatgaattatta
gcaacacttaaataa

DBGET integrated database retrieval system