KEGG   Psychromonas ingrahamii: Ping_1055Help
Entry
Ping_1055         CDS       T00450                                 

Definition
(GenBank) tryptophan synthase, alpha chain
  KO
K01695  tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
pin  Psychromonas ingrahamii
Pathway
pin00260  Glycine, serine and threonine metabolism
pin00400  Phenylalanine, tyrosine and tryptophan biosynthesis
pin01100  Metabolic pathways
pin01110  Biosynthesis of secondary metabolites
pin01130  Biosynthesis of antibiotics
pin01230  Biosynthesis of amino acids
Module
pin_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:pin00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Ping_1055
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Ping_1055
Enzymes [BR:pin01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Ping_1055
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Trp_syntA His_biosynth GatB_Yqey HMGL-like
Motif
Other DBs
NCBI-ProteinID: ABM02894
UniProt: A1STS9
Position
complement(1328926..1329738)
Genome map
AA seq 270 aa AA seqDB search
MSKRYQALFARLKTENQGAFVPFVMLSDPNRALSLKIIDTLIDAGADALELGIPFSDPVA
DGIVIQDASIRALNAGGTPDSCLEIIAEIRHKHPTIPIGLLLYVNLVYRNGIENFYERCS
KAGVDSILIADAPLEESAPYRAAAGKFAINQIFIAPPNGDQETLQKVAEYGQGYTYLLSR
AGVTGGHAKAGMPIGNMLTTLNKYHAPPSLLGFGISTPEQVREAIKLGAAGAISGSAVVK
IIEKHLDNPDKLLSEMHKFISKMKAATDKK
NT seq 813 nt NT seq  +upstreamnt  +downstreamnt
atgagcaaacgttatcaggctttatttgcccgtcttaaaactgaaaaccagggagccttt
gttccttttgtgatgcttagtgatcccaatcgcgccctctccttgaaaataattgatact
ttaattgatgccggtgcagatgctttggagttagggatccccttttcagatcctgtcgcc
gatggtattgttattcaagatgcctctattcgcgctttgaatgccggtggaacaccagac
agctgcctggaaatcattgcggaaattcgtcataaacatccgaccattcccattggtcta
ttattgtatgtaaaccttgtttatcgtaatggtattgaaaatttttatgaacgttgttct
aaagcgggtgtcgattctatattaatagcagatgcaccacttgaagaaagtgcgccttac
cgcgctgcggctggaaaatttgccattaaccaaatatttatagcgccccctaatggcgat
caggaaacattacaaaaagtggctgaatatggacagggttatacctacttgttaagccgc
gcgggggtgaccggtggacatgccaaggcaggtatgcctattggaaatatgttgacgaca
ttaaataaatatcatgcgccgccgtcattactgggttttggtatttccacacctgagcag
gtacgtgaagcaataaaattgggagctgctggcgcaatttcaggttccgctgtggttaaa
attattgaaaaacacttagataacccggataaactgctttctgaaatgcataaatttatc
agtaaaatgaaagctgccaccgataaaaaataa

DBGET integrated database retrieval system