KEGG   Psychromonas ingrahamii: Ping_1623Help
Entry
Ping_1623         CDS       T00450                                 

Definition
(GenBank) methionyl-tRNA synthetase
  KO
K01874  methionyl-tRNA synthetase [EC:6.1.1.10]
Organism
pin  Psychromonas ingrahamii
Pathway
pin00450  Selenocompound metabolism
pin00970  Aminoacyl-tRNA biosynthesis
pin01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pin00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    Ping_1623
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    Ping_1623
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:pin01007]
    Ping_1623
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:pin03016]
    Ping_1623
Enzymes [BR:pin01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.10  methionine---tRNA ligase
     Ping_1623
Amino acid related enzymes [BR:pin01007]
 Aminoacyl-tRNA synthetase
  Class I (U)
   Ping_1623
Transfer RNA biogenesis [BR:pin03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    Ping_1623
 Prokaryotic type
   Other AARSs
    Ping_1623
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: tRNA-synt_1g tRNA_bind tRNA-synt_1 tRNA-synt_1e tRNA-synt_1f
Motif
Other DBs
NCBI-ProteinID: ABM03420
UniProt: A1SVA5
Position
complement(1976194..1978254)
Genome map
AA seq 686 aa AA seqDB search
MEIQQRKILVTCALPYANGPIHLGHMLEHVQADIWVRFQRLRGHNIHFICADDAHGTPIM
LKAQEMGIKPTDMIADIRASHESDFSGFNISFDNYHSTHSEENQALSSQIYIALRENGYI
TNRTISQLFDPEKKMFLPDRFVKGTCPDCKADDQYGDNCDACGATYSPTEMINPKSAVSG
STPIMKDTEHFFFDLPQFEDMLKVWTKSGALQTEMANKVGEWFETGLKQWDITRDAPYFG
FEIPDAPGKFFYVWLDAPIGYMGSFKNLCDKTEGLNFDDYWKKDSAAELYHFIGKDIVNF
HSLFWPAVLEGAGFRKPTAVNVHGYVTVNGAKMSKSKGTFIKASTYLDNLDPECLRYYYA
AKLTSRIDDLDLNLEDFTQRVNSDVVNKLVNLASRTAGFITKKYDGQLSNHVSEPQLYQS
FIDAGTSIAALFEQRDFARAIREIMALADIANKYIDEKAPWALAKQEGSEVKVQEICSMG
INLFRVLMTYLKPIIPKLAARSEDFLAETLDWEIIKKPLAGHRINKFKALFQRIDPKHVE
AMVDASKDSLEADKAAKQKQAAAQLDAAKSELDKEPLAPEIDFDTFAKTDLRVALITKAE
AVPKANKLLKLTLDLGGETRTVFAGIKSAYTPEELEGRLTVMVANLAPRQMKFGLSEGMV
LATGPGGKEIHILNPDDGAKPGQRIM
NT seq 2061 nt NT seq  +upstreamnt  +downstreamnt
atggaaattcaacaacgtaaaatccttgttacctgcgccctaccctatgcaaacggtccg
attcatctcggacacatgcttgaacatgttcaagctgatatctgggttcgttttcagcgt
ttacgtggtcacaatatccattttatttgtgcagatgatgcgcacggcacacctattatg
cttaaagcacaagagatgggtattaagccgaccgatatgatagcggacattcgagcttct
cacgaaagtgatttttccgggtttaatattagctttgataactaccacagcacccatagc
gaagagaaccaggcgttgtcttcacaaatttatatcgcactacgtgaaaatggttatatt
accaatagaactatctcacaattatttgatcctgaaaaaaagatgtttttaccggaccgt
tttgtcaaagggacctgtcctgactgtaaagctgacgatcaatacggcgataattgtgac
gcttgtggcgcaacgtatagcccaacagagatgattaaccccaaatcagcggtttcaggc
agcacgcccattatgaaagacactgagcatttctttttcgatctgccgcaatttgaagat
atgttaaaagtctggactaaatcaggtgcgctacagacagagatggcaaataaagtcggt
gaatggtttgaaaccggtctaaagcagtgggatattacccgtgatgcgccttactttggt
tttgaaatacccgatgcaccgggtaaatttttctatgtttggttagacgcaccgattggt
tacatgggcagctttaaaaacctctgtgataaaaccgagggacttaactttgatgattat
tggaaaaaagacagcgcagctgagttataccatttcatcggtaaagacattgttaacttc
cacagcctattttggccagctgttttagaaggtgccggattccgtaaaccaacggctgtt
aatgtacacggttatgtcacagtaaatggcgcgaaaatgtcaaaatctaaaggcactttc
attaaagccagcacctacttagataacctggatcctgagtgtttacgttattattatgca
gctaaattaaccagtcgcattgacgatttagatttaaaccttgaagattttacacagagg
gtaaactccgatgtggttaacaaactggttaatcttgcatcacgtacagcgggttttatt
actaaaaaatacgatggtcaattatcaaaccatgtttctgaaccgcagttatatcaatca
tttattgatgcagggacaagcattgcagcattatttgaacaacgtgattttgcccgtgcg
attcgtgaaataatggcattggctgatatcgctaacaaatacattgatgaaaaagcaccc
tgggcattagcgaaacaggaaggcagcgaagtgaaagtgcaggagatctgctcaatgggg
atcaacttattccgtgttctaatgacttatctaaaacctattatcccaaaactggcggca
cgcagtgaggactttctggcggaaacactggattgggaaatcattaaaaagcctcttgcc
ggtcaccgcatcaataaattcaaagcgttattccaacgtattgatcctaaacatgtagaa
gccatggttgacgcatcgaaagacagtctggaagcggataaagctgccaagcagaaacaa
gcagcagcacaacttgatgctgcaaaatcagaactggataaagagccgctggcaccggaa
attgactttgatacttttgctaaaacagacttacgtgtcgctctaatcacaaaagcggaa
gcagtacctaaggctaacaaattacttaaactaaccttagatttaggcggcgaaacacgc
acagtattcgccggtattaagtcagcctatacgcctgaagaattagagggcaggttaacg
gtcatggttgcgaacttagcgccacgtcaaatgaagttcggtttatcagaaggcatggta
ttagcaacgggtcctggcggtaaagagatccacattctaaatccagatgatggtgcaaaa
ccgggccaacgtataatgtaa

DBGET integrated database retrieval system